Identifiers and Description

Gene Model Identifier

Contig169.0.g12

Standard Name

LSF1a

Aliases

Contig169_0_g12

Description

Tubulin-tyrosine ligase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03133 ) Tubulin-tyrosine ligase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005435802.0008536325002377e-42Leishmanolysin family protein
SGDYBR094W0.00003998524687536623PBY1 SGDID:S000000298, Chr II
from 432036-434297, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig169.0.g12(coding)
ATGATATTTAGATATATTAAGGCGCTTCTGTAAGCACTTATAGAAGAGAACAACTAGAAA
GGTTGGAAAGAGACTTTATCTAAAGAAAAGTATGATATGAAATGGGTTTCTTCAGGAATT
GAGGATGATGAATTGATTAAAATCTTAAACAATCAAGATAAAAAGGTGTTGATAAATAGA
TATCCTGGAATATAAGGACTTGTTCATAAAGATACTTTTATCAGAGTAATGAGCATAGGG
TTGACAGAGATTCCTACATAATTGGGAGCCGAAATGGTAGTTCAAAGATACATTCACAAT
CCATTATTAGTGGAAGGACTCAAGTTTGATTTAAGAATTTATGTAGTAATAACTCAAGTG
AATCCTATTTAAGCCTTTATTTGTGATGAGGGTCTAGCTAGGTTTTGCACTGAACCTTAT
GAGACTCCTACAAAGGAAAATTTTAAAAAGTTTTTTATGCATTTGACAAATTACTCTATA
AATAAGCATCATGAAGATTATAAAGAATCAGAGAATATCTTAGAGCCAAATAATGATACA
AAAAGAACATTAGAGTCACTATACAAGACTTTAGATAACTTGAATATCAACACAGCTTAA
ATTAAAGAAAATATCAAACAAACTTGTATGAGAACACTTTCTGTTTATGGTCCCATTATT
GAACATGGTGTAGCAGTAGCTTCTAATATGAAACCAATAAATGGAAAATATTTCTAAATT
TTGGGATTCGACTTATTGATTGATGAAAACTTAGATGCTCATTTGCTCGAAATAAATGAT
CATCCATCTTTGAATATATTTCTTGAAAAAGACTATATGGGAGGCGGTATGGGTAAATCT
CTCTCCTAAATTGACCTCTATGTTAAAAAACGAGTAGTTGGGGACTCAATAAAACTCAGT
AAAAAGTCTTCTCAATAGTTAAGGGACCTATAAGAGTTCAGATCTTTGACAAAGATTTAC
CCTGATGAGCAAGATGAAAGCAGTGAAGTTGCCAGACTAATGAACAAATTAAGATAGATT
TATTATGAGATAGCCCCATGTGGTATAATAAAGGCTAGTCAAGAATATCAGGCATCCTAA
TATTATTCTTCGACTAACATAGCAAATTCTACACATAAAGTAGAATCCATTGAAAAATTA
TTTCAGAATAAAAACGGTATTCCGACAACAGATGTATAGCAGTTCAAGGGCCTAAATGAA
TAAGAATAATTGGAATAACCAAATTCATTTGTTCTCAACAAAGAATACGTCTTATCTGAC
ACCAATGAATTTTCATAAAATATCTTTTATCCCAGTTACTTTGAAGGTCCAGAATAGGAT
AAGACTTTAAATTTGACTTAATAAAGATTTATGGAGTATAAAACTCGAAACGCTTTGAAT
TCTGACCTCTAGGAATTATTAATTGAAGACTTTTAGGATCAAAGATTGCTTGGGGAATCA
AGCATCATTAAGCTCAAAGATAAAGATCCATTCAAAGATTGTGAAGATTCTTACTTTAAG
AATACAGATAAGAAGTGCTAGTCTTGCCCAACTGGCTGTAAAAAATGCTCAAGTCTTGAT
ATGGCAGACTAGTGCGAGAGTGGCTTTACATTAATTTATGGAAAAAATTTCGGATACTGT
TTCCCGACCTGTCCTGTTGGCTACTACATTTAAACTAAATTCACAAACAAAAACAGCTAC
TTAGAGAAGAATAGAAATGCTAACACAAATTAGAAAAATCAAAATCCTACTCTAATGGTC
AGTCAATGCTAGAAATGTAATTTCGGCTGTGGAGATTGTTTCTTTGACGAGTATTATCTC
AAGCCCTTTTGTTACACATGCATGAAAGGCTTCAAATATAATGAAACTTCAGGGGGTTGT
GATGTTGTGCCTTGCAAATCTGGAGAATACAGGCCAAAACCATTGAACAGTTCTGTGAAC
ATCGATGTAGATTCTAAGTATGATGATTATCTCTGCTAACCTTGTTCCAACGGATGCGTA
AATTGCACAAACACCACTACTTGTATGACTTGTGACTCTGGATTCGCAATATTTAAAAAG
TAAGCATAGATTAACAGTTCATGTGTTGGTTGTACTTCATATTGCAAAAACTGTGCAATA
ATTAACTCAACCACTTCAAACAAAACTAACTGCACTGCTTGTATCCCAAAATTCATACTG
AAAAATGATAACACCTGCGAACTCAATAGAACTTGTGCTGTGGGTTATTGGTTTAATGAC
ACCAAAGTTGAATGCTAAACTTGCCCTGATAATTGTCCAACGTGTAAGTAAGGAGCAAAG
AATGGAACAGTAATTTGTACTACATGTACTCAGTAATCTGTTTTAAATTCCTAAACTCAA
CTATGTGATGATAGATGCAACAGTACAGAAGCTTTTTATAACACCAAAATATCACAATGT
ACAACATGTTTTAACACTTCATTCCCTGATTAGTCTACTTAAGCTTGCTTAAGCTGCCCC
AACTATTGTAATAACTGTTACTATAACAAAACAACAAAGAGACCAGAATGCAATAACTGC
ACTCAAGAGGGATATATGGATTAAACACAGAAATAATGTAGAGTGAATTGTAATGACTCT
GCAGTATTTAATTTTGATAAGGGCATTTGTGTAAACTGCTTAGCTGGTTAATTCTTGAAT
ATTTCAACTAATAGTTGCTAATCCTGCCCAACCAATTGCTCAAGTTGTTCTTTCAGCAAG
CAAAATAGTAGGGTTGAATGCTCAACATGCAATAACAGTATGATAGTTGATTATTCAACA
AAGAAATGCAGAAAATCTTGCAATACTTCTCAATAGTATGACTGGACTAAGAATACTTGT
GTAAATTGTTCTTCTAATACTATATATAATTCCACAACATAGCAATGCTAAGCATGCCCA
AATGGTTGCAAGTCATGCGCTTTTAATTAAACATCTCAGAGAGTTGAGTGCAGTGTCTGT
GATACATTTAAAGTTCTAGATGCTGATAAGAAATTATGTAAAGATAGTTGCTACTTTGGG
AAGACTTACTTCTGGGAAGCTTAGGAATGCAGGTACTGTCCTCTTTATCAATACAAAGGA
AGTGATGGTTAATGCAAGAAGTGTCCATTTGGTTGCCCTGACTGTTACAGTCAAGGTTCT
AACACTTACTGCAACAGATGCAATGAAACAACAGTATTCGACATATGGTCATGGAAATGC
AAACTGGAATGCACAAATTAGACTGTCTTTAACTGGGATACAAACACTTGTGAAAATTGC
CCATCTGGTTAGTATTTTGATACTGCCTCTAACAACTGTAAAACTTGTAACACCAATTGT
GCCAAATGTGAAAAGAAATTTTGGTATAGTGCAACAACTGATTGTAAAGCTTGCAAGGAT
GGCTATGTTCTAGATGTTAAGAACAATGTTTGCAGAAAACCTTGCCCTAGTACATAAATA
TATAACGACACAACTTAAAAATGTCAAAATTGCTCTTCAAATATGTTTGTGAACATCACA
TCTCAACAATGCTAGACTTGTCCATCAGACTGCTAAGATTGTATAATGGATAACAATACA
TTGAAAGTAAATTGTACATCTTGTAAATCTGGAATTTACGATTCATAATAATATAAATGC
AGACCTAATTGTGACTCCGAAAAGTACTTTAACTGGACTTAATCAACTTGTCAAGATTGC
CCAACATCAACATACTTTGAACAAAAGACTTAACAATGTGAGTCATGCCCAGTCAACTGT
ACTAAATGCATAAAAAATAATCAAGGCAAATTTGAGTGCTAATCATGTGCTTCCAATACT
TAACTGGATGCAGAAATGCTACTTTGCAAGCCGGATTGCCCTTCTAAATAGATATATGAC
TTTGATTTGTTCAAATGTAGAAGCTGTGGAAATGGTCAATATTAAAATTCCACGTCAAAA
TGTGCTGACTGCCCAGGTTATTGCACATCATGCGAATACTTTACTGCAAATAAGTCAACT
AGCTGTTATACATGCAAAGATGGAAGTTATCTAGACAATACTAAAAAGGATTGCAGGCCA
TATTGTAGTGATTCATAATACTATGATTGGTCTAAGAAAACTTGTGTAAACTGTGCATCA
ACTACATTCTTGAATAAGACTACAGACTAATGCTAGAATTGTCCAAACTAATGCTAATCA
TGTAAATACAATCCAAATACAAATTCAGCAGAGTGCTCGACATGCAAATCTGGCTATGTT
TTCGATAGCTAATATAATGACTGCAAATTATCTTGCAACTCTACAGCTTATTTTGATTGG
AATTCTAGGACTTGTATAAATTGCGCATCAAATCAATTTCTTAATTAAGATATAGGCTAA
TGTCAAAACTGTCCAAGCGGATGTCAAAATTGTGTATATAACTAAAATACATAAAACTTG
TAATGTGGATCTTGCTCATCAGGTTATACTTATGATTAAACTATGAGACTCTGCTATCCT
AACTGTGGTGCTAATTAATTTTATAATTGGGATACTAACATGTGTTAAAAGTGTCAAAGT
ACCTAATACTTAAATTCTACAACATTATAGTGCAATGATTGCCCTTCAAACTGCGCAACT
TGTTCACTTAACTCAGATAATAATGTAAAATGTGATAGTTGTTCAAGTGGATTTTAATTG
GATTCTACTACTTTTACTTGTAGACAGTCATGTAACTCAACTTCAGTTTATAACTCAAAT
ACCAAATAATGTACACAATGTTAGGTAGGTACCTGGTTGAACTCAACAGCTTAAAATTGT
TAATCCTGTCCTTAGGGATGCTATTAATGTTCTGCAAACTCTTTAGGATAGCCAGAATGC
TCTAGTTGCTTAAGTGGATTAGTATTAGACTCTAGTACAAAAAAATGTAAGAAATCCTGC
ACAACTGGTTAGTATTTTGACTACGATACATTTGAATGCAAGTCATGTTCTTCAAATTGT
GATGTCTGCTCAAGCTCATCTACTTGCACAACTTGTAATGAATAATATACACTTCAAAGT
GGTTCATGCACCAATAAATGCACTTCAACTCAGACTTGGAATACATCAACTAAAAAATGC
GATGATCCAGTTTCAAGCGTTGCCAAAATTACTCTATCTGCTTCATCAGCAAGTATGATT
AGATGCAGAGAATATACAGTCTCGATTGCAATTGTTTCAGGTATGACAACTGGAAATGTT
AACTCTGTAGTCTGGAGTTATACTAACGATCTAAAAAGAACTGGAGACTATGTTATCAGG
CTTGATGCAATAATAAAACAAGCAAATGTTGATAATGCCTTAAGTATTAAATTAGACAGT
CTTTTCACAGAATCAGTTACTGCTTAATTTAGCATCACCATTCTAGCAACAGTTTCTTCA
ACAAATACTTCTACCGCTACGAACTCAACTAAATTCGTAATTTATCCTTAGAGATACACA
ACAATCTCAAACTATAATACATCCTACACTATCGATGGAACAGTTGGCTTAACTATAAAA
CCATAGTTTAACTACCCAGAATGTACATTGGAGAAAGGTCCTATTGATCTACCAACAGGC
ACAGATATTGGTTGCCAACTCTATGACAGCAGGAGCAATTACATTAAGGATTTAACCAAT
TGCAAAATAGCTGCAAATGATGCCACTAATGGTTTGGCTTACTTCGTAAAGTATTACTAC
TTACCTCATGCTTATCAAACAGCTTTGAGAGATACAATTACAATAAGCACAATTATAATA
CAATCATCTTGTCAAATAGCCAGTTCCAATTTGATTACAGTTTCTCAATCTGAATCCCTG
ATGTTGAATGTTAGTGTATAAAACTAGAAATCAAGCTTCGTTTATAAATGGGCTTGTTAC
TCACTAGTTTCTGGAGCTTAATGTGGAGTAATAGCTGCCACTTAAAATCAACCAAATCTT
AACTTGCCTGCATCAGGCTTTACAGGAAATGCCAAATATGCGTTCGTGCTATCAATCTTA
GACAACTCAGTTAATCAAACAGCTTGTACAGCTTACGTCCAGATTAATTCAGCTTTTTCA
GCTAATTTTGCTCTATTACTAGCAACATCATCCTAATCTGCAACATATATGGATTCATCA
GTCAGTAATAATGTTTTGTGCTCCCAAACAAAAACTAACTCAAGCGATGTCTAATATAAA
ATATCAATTATAAAGGTTAACAACTCACAGTCTTCAAGTGGCTCCTCTTCATCATCTAGC
TCATTGAATTCCAAAACTATTGTTAGTCAGTCAGCAGTTATAGTGTAATAATCTAATGCA
GTAGTAATTCCTAAAGACACTTTACAGAAAGATACTACTTATCAAATAATTTGTAATGCA
GCTAATGACAATGCAAATGAATCAGTCTCTACTACAATAAATACCAATATATAGTTGAAT
TAAGATTTAGACTTTTAAATAACCCCTAAATCAGGAATAGAAAAATCTACAGTATTTAAC
TTTAAAGTAGTGAAACCTAAAGATCAAGATTTATGGTGCAGATTTGGATATAATTTAACT
AAGGGCACTACATACTTAAACGATTTAGTATTAACAGTTTATAATGACAAAGAACAAAAG
TTATAGTCTACTCTAGTAATGTAAAACAACAAAGCTAGCAGTTAACATGTTATGGTAGCA
AGATGCTTCAATAAAGCTGGTTAGTATTCCGAAGCCTTTTAAACAGTCACCCTCAGTAAA
AGTACAAACACTCTGGTCAAGATGGGAACTAAACTTACTGATGTCAGTTTATCACTAGCC
GCTAATTCAGGTAAATTAATCTTTGAACAAATTGAAAATCAATATGAAGCATATCAGTAA
CTAGAAGAAAATCAGTTAAGTAATTAAGAAAGAGAACAATTCTTAGCTTAGACTTTGTAA
TAAATTGAAGAAATAGCAAACTAATTGACAACATAGCAACTTCGCCAAACTTGTAACATG
CTTACTGAAATATGGAATGAAATAAAGAAGAGCCCTAAGATCTAAACAATTAAACTGATT
AATTAAATGGCAAACACTTGCATTGCTCTCTTGTTTGAGTCACTTTAAGATAATGTTGTA
AGAATATTGGATTAAGATCAATTCTTGACTTTCATTGGCATTTACGATGAAATGCTTAGT
AACTTCATATCAGCTCTCTAGAAAGAGGATAATCTGATTAAAAGATTGATAGAGTCTATT
AAGATAGGAGCAGCAAGATTAGCTTCAAACATCCAAGCAGATAAAACTATCTTCTCTGCT
TCAGGCCAGAATTTCGCAGTTTAAATAGATAAGAAGAGCAAAAGTGAACTTATAAAGCTC
CAGCAAAAGAATTCTTAAAATCAATTCCCAACTGCTTTCGAGAGCAAGAATCTTACACTT
GCTAGTTCTACAAAATAAGTTGTGGTTTCTATCCCATATTATTTGATGATGTCTCAGTAT
GACTATGTGATAATGTCTTATATCTTGATTAGCAAAGACTTGAACTACAAAGAATACAGT
GATAGACACATGAGTGATATCATTGAAGTGAATGCATACTTTTCAAGTTCACCCATAGCT
ATTACTGGAGTTTATGATATTGGGGAGATCACTATTAGCAACATGAATTAAATGATGCAC
ATTAGTTTACCTTACAATATTGGTTCTAATGAAAACAGAAATCATGCTCTATGTGGGTAC
CTGGAAGACGATGATACTACGTGGCAGAAGATAGAATGTAAAGCAGACGATGATTTCGTC
ATTAACTCTTAGTTAAAAGATACCAAGATTTGTTGTACTAATCACTTGACTTTGTTTGGA
CTGGTGTACGACAAATACTTCGACGAACTCTAAGAAATAGCATTTAGACAAATAATTTAC
TCTATGATACCAGTCTCAATGATTTACATTGCTCTCCTAGTCGCAATTGCCAATACCGTA
TGCAAATATAGAAGAAGACTGAGATAAAACCCATATTAAAATTCTAAATAAAATATGGTG
GACTAAGAATCTATGAGGAACAACAATGGAATGGTACCTTCCACATCGAGAAGTGAAACT
TAAGATGAGAGAAATATTCAAATATAGCAAATAGATAAATCACCAAATGATAAAACAGAT
TTCTCCATGATTAATATAACTCAAGTAGAAATGATGGCGAATGACGTTGAAGAACCCAGA
GCCAAAAAATCTGACAATATCAACAAAATCCCTAAAAATAAGAAGAAGTTCCCAGTAATG
AAGTCAATCTTTGAAGTAGTAAAACTCAGTAAACTCTACAAGTTCTTCTTTGAATTGAAT
AAAGAAGGAGACATATTCACCATTATATTCTAGAAAGTGATACTTTGCAACTTGTTCTTG
CTCTCTTTCACTATCACCATGATTATATGTTACTATGCAAAGGAACTTTCTATTATAATT
GTTGCTTCCTACATTATTCTTCTGCTGTTTATTGTCTTGTTTAAGTAATTCTAGGGAGTT
ATTAATAATGGCACAGCTATCAAGCACATCTGGTTCGCTTCACACTTGATACTCTTGTTT
GTCTAACCAGCTGTAATTGCTCAACTAGCTGATAATGTGTCGGTGTAAAACTTCGATTAT
TACCTAATAGGGTCATGTATCATCCTATGCATCAGTTGCACTTTTGAAGATATGATTTTG
ATACCAGCATATAACAAAATCACCAAGTTCTTAGATAAAAAACTCAAATATAACAACAAC
TAAGTTAAAAAATGA


>Contig169.0.g12(protein)
MIFRYIKALLQALIEENNQKGWKETLSKEKYDMKWVSSGIEDDELIKILNNQDKKVLINR
YPGIQGLVHKDTFIRVMSIGLTEIPTQLGAEMVVQRYIHNPLLVEGLKFDLRIYVVITQV
NPIQAFICDEGLARFCTEPYETPTKENFKKFFMHLTNYSINKHHEDYKESENILEPNNDT
KRTLESLYKTLDNLNINTAQIKENIKQTCMRTLSVYGPIIEHGVAVASNMKPINGKYFQI
LGFDLLIDENLDAHLLEINDHPSLNIFLEKDYMGGGMGKSLSQIDLYVKKRVVGDSIKLS
KKSSQQLRDLQEFRSLTKIYPDEQDESSEVARLMNKLRQIYYEIAPCGIIKASQEYQASQ
YYSSTNIANSTHKVESIEKLFQNKNGIPTTDVQQFKGLNEQEQLEQPNSFVLNKEYVLSD
TNEFSQNIFYPSYFEGPEQDKTLNLTQQRFMEYKTRNALNSDLQELLIEDFQDQRLLGES
SIIKLKDKDPFKDCEDSYFKNTDKKCQSCPTGCKKCSSLDMADQCESGFTLIYGKNFGYC
FPTCPVGYYIQTKFTNKNSYLEKNRNANTNQKNQNPTLMVSQCQKCNFGCGDCFFDEYYL
KPFCYTCMKGFKYNETSGGCDVVPCKSGEYRPKPLNSSVNIDVDSKYDDYLCQPCSNGCV
NCTNTTTCMTCDSGFAIFKKQAQINSSCVGCTSYCKNCAIINSTTSNKTNCTACIPKFIL
KNDNTCELNRTCAVGYWFNDTKVECQTCPDNCPTCKQGAKNGTVICTTCTQQSVLNSQTQ
LCDDRCNSTEAFYNTKISQCTTCFNTSFPDQSTQACLSCPNYCNNCYYNKTTKRPECNNC
TQEGYMDQTQKQCRVNCNDSAVFNFDKGICVNCLAGQFLNISTNSCQSCPTNCSSCSFSK
QNSRVECSTCNNSMIVDYSTKKCRKSCNTSQQYDWTKNTCVNCSSNTIYNSTTQQCQACP
NGCKSCAFNQTSQRVECSVCDTFKVLDADKKLCKDSCYFGKTYFWEAQECRYCPLYQYKG
SDGQCKKCPFGCPDCYSQGSNTYCNRCNETTVFDIWSWKCKLECTNQTVFNWDTNTCENC
PSGQYFDTASNNCKTCNTNCAKCEKKFWYSATTDCKACKDGYVLDVKNNVCRKPCPSTQI
YNDTTQKCQNCSSNMFVNITSQQCQTCPSDCQDCIMDNNTLKVNCTSCKSGIYDSQQYKC
RPNCDSEKYFNWTQSTCQDCPTSTYFEQKTQQCESCPVNCTKCIKNNQGKFECQSCASNT
QLDAEMLLCKPDCPSKQIYDFDLFKCRSCGNGQYQNSTSKCADCPGYCTSCEYFTANKST
SCYTCKDGSYLDNTKKDCRPYCSDSQYYDWSKKTCVNCASTTFLNKTTDQCQNCPNQCQS
CKYNPNTNSAECSTCKSGYVFDSQYNDCKLSCNSTAYFDWNSRTCINCASNQFLNQDIGQ
CQNCPSGCQNCVYNQNTQNLQCGSCSSGYTYDQTMRLCYPNCGANQFYNWDTNMCQKCQS
TQYLNSTTLQCNDCPSNCATCSLNSDNNVKCDSCSSGFQLDSTTFTCRQSCNSTSVYNSN
TKQCTQCQVGTWLNSTAQNCQSCPQGCYQCSANSLGQPECSSCLSGLVLDSSTKKCKKSC
TTGQYFDYDTFECKSCSSNCDVCSSSSTCTTCNEQYTLQSGSCTNKCTSTQTWNTSTKKC
DDPVSSVAKITLSASSASMIRCREYTVSIAIVSGMTTGNVNSVVWSYTNDLKRTGDYVIR
LDAIIKQANVDNALSIKLDSLFTESVTAQFSITILATVSSTNTSTATNSTKFVIYPQRYT
TISNYNTSYTIDGTVGLTIKPQFNYPECTLEKGPIDLPTGTDIGCQLYDSRSNYIKDLTN
CKIAANDATNGLAYFVKYYYLPHAYQTALRDTITISTIIIQSSCQIASSNLITVSQSESL
MLNVSVQNQKSSFVYKWACYSLVSGAQCGVIAATQNQPNLNLPASGFTGNAKYAFVLSIL
DNSVNQTACTAYVQINSAFSANFALLLATSSQSATYMDSSVSNNVLCSQTKTNSSDVQYK
ISIIKVNNSQSSSGSSSSSSSLNSKTIVSQSAVIVQQSNAVVIPKDTLQKDTTYQIICNA
ANDNANESVSTTINTNIQLNQDLDFQITPKSGIEKSTVFNFKVVKPKDQDLWCRFGYNLT
KGTTYLNDLVLTVYNDKEQKLQSTLVMQNNKASSQHVMVARCFNKAGQYSEAFQTVTLSK
STNTLVKMGTKLTDVSLSLAANSGKLIFEQIENQYEAYQQLEENQLSNQEREQFLAQTLQ
QIEEIANQLTTQQLRQTCNMLTEIWNEIKKSPKIQTIKLINQMANTCIALLFESLQDNVV
RILDQDQFLTFIGIYDEMLSNFISALQKEDNLIKRLIESIKIGAARLASNIQADKTIFSA
SGQNFAVQIDKKSKSELIKLQQKNSQNQFPTAFESKNLTLASSTKQVVVSIPYYLMMSQY
DYVIMSYILISKDLNYKEYSDRHMSDIIEVNAYFSSSPIAITGVYDIGEITISNMNQMMH
ISLPYNIGSNENRNHALCGYLEDDDTTWQKIECKADDDFVINSQLKDTKICCTNHLTLFG
LVYDKYFDELQEIAFRQIIYSMIPVSMIYIALLVAIANTVCKYRRRLRQNPYQNSKQNMV
DQESMRNNNGMVPSTSRSETQDERNIQIQQIDKSPNDKTDFSMINITQVEMMANDVEEPR
AKKSDNINKIPKNKKKFPVMKSIFEVVKLSKLYKFFFELNKEGDIFTIIFQKVILCNLFL
LSFTITMIICYYAKELSIIIVASYIILLLFIVLFKQFQGVINNGTAIKHIWFASHLILLF
VQPAVIAQLADNVSVQNFDYYLIGSCIILCISCTFEDMILIPAYNKITKFLDKKLKYNNN
QVKK