Identifiers and Description

Gene Model Identifier

Contig13285.0.g26

Standard Name

LPXB1d

Aliases

Contig13285_0_g26

Description

Lipid-A-disaccharide synthetase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02684 ) Lipid-A-disaccharide synthetase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009253401.999002769139511e-37lipid A-disaccharide synthase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13285.0.g26(coding)
ATGTTGGGCACACAATTAAAGAAGAATTTCTCATCATCAAACCAAAAGAACCTTAACAAG
ACTGTTGCTATTTTGGCAAACTCAAAGTCAGGTGACATCGTAGGATAAAAGATAATGTAA
AATCTTAAGGCAGTCTCTGGAGTTAACGATTTCAATTTCTTTGGTTATGGAGGTGAGCAC
ATGAAGTAAGAAGGTATGGCTGGTAACATCTAAGTGGAGCTCGACGATTTCATGGGAAAA
GAGTTCAGTACATTCAGAAAGACAAAAAATTACAGCGAAATTCAATACTCAACCAAATAT
AGCTTCGTTAACTTGATTAACAAGCATTTCGTACAGAGACAAGACGATATTCTTGACTAG
TTCGATAGAGTTGATGTGGGCAAGAAAATCTATCAAGCAAGACCAAGCGTCGTTTTGAAT
ATCGATAATGAATACATCACATTAAAAATGATGGAAGATCTCTCAAAACACTATAAGAAC
AGTGCCAACGATCTCCCATAGAGACATTTCCATAACAAGTTCGTGAAGGACTATAAACAA
TGGGCTCTCAAGTACTTAGATTTCGTCCACTATCAAATCCCAATGGTATTCGGTTCAGCA
GACGGCTTCACTTTCCCAGGTGAATACGTGGGTCAATACGCAGTTTACGAGGCCATCAGA
CACATCTATTCCAAGTCCAAGGATCTTTAGCCACTCATAAAGGAGGAATCTCTCTATGTC
AACAAGAACTACTTCGCAGCTGATTTGGAGAAGGGTATCGAAAAGGTCCGCAGAGAATTC
AGAGAAAAGCATCAAATTGAGCAACACAACACTGTCGTATTCTTTGCACCAGGTAATGAA
CTTAAGGAGGCTGAATTCTGCGTGGAAAATGTACGCAGAGGTATTAAAGAATTCATATTG
AAATACTCTAGTCCTACTTCATTGTCTCCAAAGGCACCACCCAGAGAGAACTACGTTACT
GTAATCAGTGTTGAGAAAGGCTCAGAAGTTGAGTAATACGTTAAGCAACACCTTGAAGAT
CAACCATGGACTGGCAGAGTAGTTTTCGTCTCCAATGAGAACAATGAGCACATCGACGCT
ATGGCTGCTTCAGACTTCGGTCTATCTTACGACGGTCAAATGATTGGTGCTGCTGCTGTT
TGCCACTTGCCCATGATGATTTTAGTTAAGATGAGAGTTCATCACTAGTGGTTCAGTGAC
CTCTACAATTAATGGTGGAACCAGATGAACATCATTGCTGATAACAATATCTACCCAGAG
CTAATTGGTGGTGAGGCATGGTACGGTAAGATCTGCGATACATTGGCTGAGTGGTATGTT
AAACCAGAGGTCAGATTCGATCTCATCAGAAAATGGGAATACTTCATCAAGGACGCCTGT
TCATTCCAGAGAATCGACCACTCTAAAGTGAAGGGCAGAGACATCATTCTTGCTGATGGT
CTTGCCTACGACGAAATCAAGGACCCATTCCGCCAAGTAGCCAGACACTTGTGGAAAGAT
ATTCAGAACTACGAGCTCAGAGGAGGCTAAGCAGTCGAAGATTTCTCATCACTTGAGACT
AGAGTCCCCAAGCTATATTGA


>Contig13285.0.g26(protein)
MLGTQLKKNFSSSNQKNLNKTVAILANSKSGDIVGQKIMQNLKAVSGVNDFNFFGYGGEH
MKQEGMAGNIQVELDDFMGKEFSTFRKTKNYSEIQYSTKYSFVNLINKHFVQRQDDILDQ
FDRVDVGKKIYQARPSVVLNIDNEYITLKMMEDLSKHYKNSANDLPQRHFHNKFVKDYKQ
WALKYLDFVHYQIPMVFGSADGFTFPGEYVGQYAVYEAIRHIYSKSKDLQPLIKEESLYV
NKNYFAADLEKGIEKVRREFREKHQIEQHNTVVFFAPGNELKEAEFCVENVRRGIKEFIL
KYSSPTSLSPKAPPRENYVTVISVEKGSEVEQYVKQHLEDQPWTGRVVFVSNENNEHIDA
MAASDFGLSYDGQMIGAAAVCHLPMMILVKMRVHHQWFSDLYNQWWNQMNIIADNNIYPE
LIGGEAWYGKICDTLAEWYVKPEVRFDLIRKWEYFIKDACSFQRIDHSKVKGRDIILADG
LAYDEIKDPFRQVARHLWKDIQNYELRGGQAVEDFSSLETRVPKLY