Identifiers and Description

Gene Model Identifier

Contig18109.0.g48

Standard Name

LPXB1c

Aliases

Contig18109_0_g48

Description

TPR/MLP1/MLP2-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam07926 ) TPR/MLP1/MLP2-like protein
  • ( pfam03065 ) Glycosyl hydrolase family 57
  • ( pfam08317 ) Spc7 kinetochore protein
  • ( pfam09304 ) Cortexillin I, coiled coil
  • ( pfam10187 ) N-terminal domain of NEFA-interacting nuclear protein NIP30
  • ( pfam12010 ) Domain of unknown function (DUF3502)
  • ( pfam00481 ) Protein phosphatase 2C
  • ( pfam05440 ) Tetrahydromethanopterin S-methyltransferase subunit B
  • ( pfam05088 ) Bacterial NAD-glutamate dehydrogenase
  • ( pfam09403 ) Adhesion protein FadA
  • ( pfam04156 ) IncA protein
  • ( pfam12299 ) Protein of unknown function (DUF3627)
  • ( pfam05700 ) Breast carcinoma amplified sequence 2 (BCAS2)
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam03249 ) Type specific antigen
  • ( pfam05531 ) Nucleopolyhedrovirus P10 protein
  • ( pfam07889 ) Protein of unknown function (DUF1664)
  • ( pfam08898 ) Domain of unknown function (DUF1843)
  • ( pfam00918 ) Gastrin/cholecystokinin family
  • ( pfam10211 ) Axonemal dynein light chain
  • ( pfam11488 ) Transcriptional regulatory protein LGE1
  • ( pfam08702 ) Fibrinogen alpha/beta chain family
  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam01166 ) TSC-22/dip/bun family
  • ( pfam04799 ) fzo-like conserved region
  • ( pfam07851 ) TMPIT-like protein
  • ( pfam12308 ) Neurogenesis glycoprotein
  • ( pfam08581 ) Tup N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005295103.999970367130025e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18109.0.g48(coding)
ATGGCAAATAGATTTGAATCTCAATCTAACTATAACATGCAGTCTTCAGCTGGTTTCTAG
GCATCTCAAATGCCCATTAAGAATAAAGTCAAATAAATTGATAACTCTGTGAAAGACTTC
ACAAAAAGCTTGAATGAAAATAAAAAAGAAGCCCAGTTGCTGAGATCTGAATGCGCAACT
TTCGAACATCACGCCACTGAGAACACAAACGACATTTTGAAGGAAATATTAGAAGATGTT
GCTAATTTAGAGAAGGACTTCAGAAAATTACAGCAACTTGATGTCAATGAAATGAACTTC
TTGAAGTAGCAGTAAAATCAATTGCAATAGGAGAAGATGAAACTTTAGTAAGCATGTGTA
TTGCTTGAGAATAGAGTTGCTAATTTAGAGGGGGATGTCGGTTATGAACAGTGA


>Contig18109.0.g48(protein)
MANRFESQSNYNMQSSAGFQASQMPIKNKVKQIDNSVKDFTKSLNENKKEAQLLRSECAT
FEHHATENTNDILKEILEDVANLEKDFRKLQQLDVNEMNFLKQQQNQLQQEKMKLQQACV
LLENRVANLEGDVGYEQ