Identifiers and Description

Gene Model Identifier

Contig11920.0.g23

Standard Name

LPXB1b

Aliases

Contig11920_0_g23

Description

IncA protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005295102.0004286606204839e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11920.0.g23(coding)
ATGAAGTCAGGAAGAGAAACTAGCGGCAGTTTGACAAGAGGAGGCAACAATGCCAACAGA
GATTTCAATGCTTCTCAAATAGCCATTAAGCCAAGAATTAAGTCAATCTAGGACTCAATT
TAAGATTTCAACCGTGGATTGAATGAGAACAAGAAGGAGTCTCAGTTGTTGCGCAGTGAC
CTCGCCACTTTTGAACATAAAGCCACTGAAACTAACAATGACACTCTCAAGGAAATAATG
GAGGATATTGCCAACTTGGAGAAAGATTTCAGAAAATTGTAGGCTATGGATATCAATGAG
GTAGCCTTTTTGAAGCAATAAGTGGGCTAACTAGTAAACGAGAAGATGAAGATCGAATAG
AGCAATGTGTTACTTAGCACCAGAATCAACGGAATCGAGCATGATGTAGGATTCGAATGA


>Contig11920.0.g23(protein)
MKSGRETSGSLTRGGNNANRDFNASQIAIKPRIKSIQDSIQDFNRGLNENKKESQLLRSD
LATFEHKATETNNDTLKEIMEDIANLEKDFRKLQAMDINEVAFLKQQVGQLVNEKMKIEQ
SNVLLSTRINGIEHDVGFE