Identifiers and Description

Gene Model Identifier

Contig13285.0.g25

Standard Name

LPXB1a

Aliases

Contig13285_0_g25

Description

IncA protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005295102.0004286606204839e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13285.0.g25(coding)
ATGAAGTCAGGAAGAGAAACTAGCGGCAGTTTGACAAGAGGAGGCAACAATGCTAACAGA
GATTTCAATGCTTCTCAAATAGCCATTAAGCCAAGAATTAAGTCAATCTAGGACTCAATT
TAAGATTTCAATCGCGGACTGAATGAGAACAAGAAGGAGTCTCAGTTGTTGCGCAGTGAC
CTGGCCACTTTTGAACATAAAGCCACTGAAACTAACAATGACACCCTCAAGGAAATAATG
GAGGATATTGCCAACTTGGAGAAAGATTTCAGAAAATTGTAGGCTATGGATATCAATGAG
GTAGCCTTTTTGAAGCAATAAGTGGGCTAACTAGTAAACGAGAAGATGAAGATCGAATAG
AGCAATGTGTTACTTAGCACCAGAATCAACGGAATCGAGCATGATGTAGGATTCGAATGA


>Contig13285.0.g25(protein)
MKSGRETSGSLTRGGNNANRDFNASQIAIKPRIKSIQDSIQDFNRGLNENKKESQLLRSD
LATFEHKATETNNDTLKEIMEDIANLEKDFRKLQAMDINEVAFLKQQVGQLVNEKMKIEQ
SNVLLSTRINGIEHDVGFE