Identifiers and Description

Gene Model Identifier

Contig14971.0.g38

Standard Name

LPIN1b

Aliases

Contig14971_0_g38

Description

LNS2 (Lipin/Ned1/Smp2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002159703.9989468726312675e-65hypothetical protein
SGDYMR165C3.000745802558524e-63PAH1 SGDID:S000004775, Chr XII
I from 592628-590040, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14971.0.g38(coding)
ATGTAAAGTATCTGCACTTAAATCTACCCTCAAGAAGAGTTTATTAACCCTACAAGTGAA
GAAACAATTATGTATTCAGGGATGCGCAGCCACTGTTTCGTCAAACTCTAATCCAATTAC
TACCCTATTAAACAGTCTGCAGATGATCGCTAGTGCTACAGATCATTGATGTGCTTCAAG
AACCTGGATGAAGTCAGAAGACTCTATAAGGATATTAGCTCAGGATCATATGAAAGCATG
GATGAGAAAAATGTCCCAAAGGAAGAACATATGAGTGAATTAAATGTGCAACTATGTCTT
TAAACTGTTAAGAAATGCCAACCAAAGAGTCTGAAGGATGCACTAACTTATGTTGGTTGG
TACATGAAAAAAATTAAAATTACAAAACAGGAGTTTAAGGATGTGATGTAAACTTTGCTC
AGCACTAAAATGTACATCTACAGATAAACAGGTAAACTACAGTAGAGTTACACAAAAGAT
GAAGCTCCATTGGAGCAAATAAACGAGCACCTACCCCTAGCATTCTGTCCAATTTGCATG
CTATTTTTGTGTACCAAACATCTTGATGCTAATTAAGAAACTAATACTTGGATCTTTCAA
AGAATAAATCAAACTCTCAAGCTAAACTTTGATCTGAATATGTTGAAGAGAGAAAAATCA
GCAAAACACCTGAAAGAATGGATTTTTAACGTTGAAAATGTTTGTGATGCCAGAAAAAAT
TAAGTTCCTAAGTAGAGTAACAAGAAGCAAAATACACAAGCTAAACTCAATCAAGTAAAT
AACTAATTAGAAGCATTAAGTAATATTCCTTATCCTGAGAAATTAGTAAATAACTTTGAC
TTCATAATTAAAACTTTTTAAACTCTGAACCCCTGCTTCCTCAAATTGCTATATAACAAG
TTCAATAACAAGAAGTACAAGTGTAACTAGATTTCAGGGATTATAGAGCACATCAAAGGT
ACCTACCAAAACTGTGTGGATGCAGAGGACTTGCTTATTCAACCTAAAATAAAGATAACA
ATGCAAGATATTAACAGAGTCTGCGACATGTAGTTCTACGAGTAGAAACTCAAGTATCAA
ACAAAACCTTAGAATGATGGTATCCCACACTACTCGCCTTGTGATCATTAGGGAGCTTGT
ACAAGTGATTGTTCATGCATTCAAAGTGGATTGCTCTGTGAGTCGTGGTGCTGCTGCAAG
AACTACTGCCTCAATGCTTTTCCAGGTTGCAGTTGCAAAGGTGAGAAAGATTGCGAGAAC
AAAAATAAGTGCTTGTGTTTGAAGTACAACAGAGAATGTGACCCTAATAAGTGCAGAGGG
TGCAGATCTTATGTTACTCATAACGCAAATGCTAATTATCAGCATACCTAAGCTATGCTG
CAGGGAAAGCTATCTGTAAATAAGGTAGGTGGTTAAATGTAGCAGTAATCCTTGGCAAGA
CTTTGCAAGAATGTGCCTTTGACTTTGAACTTCCCTTGCAAGAGAGTCTTCACAGCGAAA
TCTACACTCTGTGATGAGATTGTTGGGTTATTTACTATGGACCGAGTTAAGAAAGATGAG
TTGATTATGGAGTATACTGGGAAAGTCATCACCTAAGAGGGCTAGAAAGAGACTGTTGAC
TAGCTAGTAAATGATCTTAGAGGGCGTTCCTATGGTTTCACTTTGGATAGATTGACAACT
TTAGATGCAGTATATGTAGGTAATTTGATGCGATTCGCTAATCACTCAAGCGATAAACTC
TCCAACTGCAAAATCAACATGATCTTTGCGCAGGGCATGTAGAGAGTCTGTTTGGTGGCC
AGTAGAAACATTGATTAAGGGGAGGAACTGTTCTTTGACTATGGCTTCTCAAAGGAGTTT
GAGTGGCTTAAGGACTATGATCGCAATGGTTGCATTGATGTGATAGTAATTAAACAACCA
GACGGCACTTTAGTGAGTTCACCATTCCACCTGCGTTTTGGCAAATTGAAAGTTCTCAAA
TCAAGTGACAAAATTTTAAGTGTGAAAGTGAATGGATAAGCGACAGATTTAGTTATGAAA
CTTGGCTCTGCAGGAGAAGGGTATTTCTTGCACGAAACCATGGATGAAAATTATGATGAT
GATTTGCGTGCAAGTAGCCCTGCAATGAGTTCAGGTGAAGCATCTCCCAATAGAAATTAC
TCTTCAGGTGATGAGAATGATGAATAAGAAAGGTTGCAGTAAGAAGCAGTCAAAATGAAC
GACTTAGAATAGATAGAATAAAAATTAAAGGAACTTGACTAATAATTAGTACAGAAAAAT
GATGATGACTTGATAGATGCCTAAGCTAGTGATCAAATAAATACATCAACGTCAACATAA
AATACGTAAAAGCCCACCCCAGTACTTCAAGATCTAGATGAAGAGGAAAAAGTTGATTTA
AGATTACTTTAATAGTCCCCAAAAGCAATCCAAAGATCAATTGAAGAACAATTTAAGCAG
GAATTAGAAAAAGAAAAAGAGAAGTAAAATGATGGTTTATCTAATAAAAATGACAAAAAG
GTGGAGAGAAAGAGTCGATGGACTTGGTTTTGGGGTGAGTTACCTGAGAAACAAATTAAA
GATCAATAGATTGAAGAAGTGAAATAAACCGAAGAGACTACTGGTCTTCAATAAGATTAA
CAGTAAGATGATCAATAAAAGCAGCCACCCCAAATTGTTCTCGAATAGGATAGTTCTCCA
TAGAGAATCGAGCAAATTCCACAACCAGATTAAATTTTAATATCTCCATAAGAAGATTCA
AGTTAAGTTCTAAGCTCCCCTCAGCAGTAAAGAGTAGTAAACAAAGATCAAAATAATCAA
TAGCTAGAAAATGTACAGGCAACTGCTCAATTATTGCCAAATTAACCCAATAACATAATG
GATTTAACTTAACCATCAAATGAATAGGAGAAAAAAGGTTTCTTGCGTAGAATGTTCGGT
TATTTCAAGAAATCACCCTCAGAACAACCCCTGCTTATCGACTCCTCTTAATAGCAAAAC
GTAAGTTCAAATAATCTTAATGGTTATGGTCAGCATTAAATGACTACTGAGGAAGAAGAT
GAAGCAAGTGAGATTAATTTATCTTTATGCGCTCATTTGATAATGCCAATCGATGGTGTT
CAAAAATCTGATGAGGAAATTATCATGGCGTTTGAAAACCACAAGATTACATATGAACAG
TTCTGCCAGAGTCCACACCTATTGCTTATGGATTCTAGATTAGTTATAAGAATTGAAGAT
TAGTATTACAATTGGGCAACCGCAGCTCCATTTATCATATCTATGCTAGCGTTTAAATAA
CCCCTCTCCACAGATATTATTGTGACTAATGATTAAGAGATTGATATGAATTAACAATAA
GACCAATAACAATAGCAACAGGAGCAGATATAATCATATCAAACTCAGTCACAATAGTAA
CAGCATTAGCACTAAAAGATAACGAATGCAAAAGATTTACCACAAAAGAACTTCTAAGAT
GATTCCCCAATTTAACAAAATTCAGCTAAAAAGTAGAAGGTTCATTATAGGAAAAGTCTA
ACACCCACCTCAGATCAACTCAAAAAGCTGAATCTTCACGATGGATCTAATGATATCATA
TTCAAAGTGACTACAGGTCTCTTGGGTGAGTAGTAAATACAAGGGAGAATCTTTGTATGG
GATCATACATACAAAATAGTTATATCTGATGTAGATGGAACAGTCACTAAAAGCGATATG
CTTGGACATTTGTTGCCTAGGTTTGGTAGAGATTGGACACATCAAGGCATTGCTAAACTC
TACACTTCTATTGCAAAGAATGGTTACAAGATTTTGTACCTTTCCTCAAGACCTATCGGT
TTGGCTGATACAACTAGAGAATACTTAAAGGGTATCAAGCAAGATGAAAATTTTAACATG
CCTGATGGTCCTGTCATTATGAGTCCAGATCGTATGGTAAAATCTATGACAAGAGAAGTA
ATTCTTAAGAAACCTCAGATGTTTAAAATAGCAGCTTTGAAGAACATTTACAACCTCTTT
CCCGAAGAAAGCAATCCCTTCGTTGGAGGTTTTGGAAACAGAGACACCGACGCAATTTCT
TATAGAGCAGTGGGCATATCCCTAGACAAGATATTCATTGTGAATGATGATGGAGAAATT
TATCACTTCAACAGCTAAAACAAGAAAAGTTATTCATTACTTAATGATATTGTTGATGAC
ATGTACCCATCTGTTCTTGAAGGGCTTAAATAATTAGCAGAGACTGTAAAAGATAGTGTG
GGAAATGTAGTTGAGAAAATTGAAGATAAACTATTGAATAATTCAGGGGACAAAGATAGC
TAGGATGATTCAGATAAACAAAATGACCAGAATAATGTAGAAAGCTTAAAGATCTATGAA
ATCGCTGATTCTAAGGATCTCTTTAGCGACAACACTTAGAACATAGAACCAAATCAAAAT
ATAGCAGAACCCCAACTCTCGCACTACGACGAAGAACAATCAATAAATAATGTGTTAGAG
AAATTTGAGGAGGGAAAAAATGAGCCCAATTAAGATCCTGTAAATGCACAATCAAGTAAT
ACACTAGACAGCTAAGGAAGTGATAATACCAATCAGAATAACAATCAACATGAAGAAACC
AAGGATTAAGAAGATACTCAAGAATATTCGGGTTAATCACACAGAAATAATGGTGATAAG
GCTTTAACAAATACTTCTAATACTTTAACTATGGATTGA


>Contig14971.0.g38(protein)
MQSICTQIYPQEEFINPTSEETIMYSGMRSHCFVKLQSNYYPIKQSADDRQCYRSLMCFK
NLDEVRRLYKDISSGSYESMDEKNVPKEEHMSELNVQLCLQTVKKCQPKSLKDALTYVGW
YMKKIKITKQEFKDVMQTLLSTKMYIYRQTGKLQQSYTKDEAPLEQINEHLPLAFCPICM
LFLCTKHLDANQETNTWIFQRINQTLKLNFDLNMLKREKSAKHLKEWIFNVENVCDARKN
QVPKQSNKKQNTQAKLNQVNNQLEALSNIPYPEKLVNNFDFIIKTFQTLNPCFLKLLYNK
FNNKKYKCNQISGIIEHIKGTYQNCVDAEDLLIQPKIKITMQDINRVCDMQFYEQKLKYQ
TKPQNDGIPHYSPCDHQGACTSDCSCIQSGLLCESWCCCKNYCLNAFPGCSCKGEKDCEN
KNKCLCLKYNRECDPNKCRGCRSYVTHNANANYQHTQAMLQGKLSVNKVGGQMQQQSLAR
LCKNVPLTLNFPCKRVFTAKSTLCDEIVGLFTMDRVKKDELIMEYTGKVITQEGQKETVD
QLVNDLRGRSYGFTLDRLTTLDAVYVGNLMRFANHSSDKLSNCKINMIFAQGMQRVCLVA
SRNIDQGEELFFDYGFSKEFEWLKDYDRNGCIDVIVIKQPDGTLVSSPFHLRFGKLKVLK
SSDKILSVKVNGQATDLVMKLGSAGEGYFLHETMDENYDDDLRASSPAMSSGEASPNRNY
SSGDENDEQERLQQEAVKMNDLEQIEQKLKELDQQLVQKNDDDLIDAQASDQINTSTSTQ
NTQKPTPVLQDLDEEEKVDLRLLQQSPKAIQRSIEEQFKQELEKEKEKQNDGLSNKNDKK
VERKSRWTWFWGELPEKQIKDQQIEEVKQTEETTGLQQDQQQDDQQKQPPQIVLEQDSSP
QRIEQIPQPDQILISPQEDSSQVLSSPQQQRVVNKDQNNQQLENVQATAQLLPNQPNNIM
DLTQPSNEQEKKGFLRRMFGYFKKSPSEQPLLIDSSQQQNVSSNNLNGYGQHQMTTEEED
EASEINLSLCAHLIMPIDGVQKSDEEIIMAFENHKITYEQFCQSPHLLLMDSRLVIRIED
QYYNWATAAPFIISMLAFKQPLSTDIIVTNDQEIDMNQQQDQQQQQQEQIQSYQTQSQQQ
QHQHQKITNAKDLPQKNFQDDSPIQQNSAKKQKVHYRKSLTPTSDQLKKLNLHDGSNDII
FKVTTGLLGEQQIQGRIFVWDHTYKIVISDVDGTVTKSDMLGHLLPRFGRDWTHQGIAKL
YTSIAKNGYKILYLSSRPIGLADTTREYLKGIKQDENFNMPDGPVIMSPDRMVKSMTREV
ILKKPQMFKIAALKNIYNLFPEESNPFVGGFGNRDTDAISYRAVGISLDKIFIVNDDGEI
YHFNSQNKKSYSLLNDIVDDMYPSVLEGLKQLAETVKDSVGNVVEKIEDKLLNNSGDKDS
QDDSDKQNDQNNVESLKIYEIADSKDLFSDNTQNIEPNQNIAEPQLSHYDEEQSINNVLE
KFEEGKNEPNQDPVNAQSSNTLDSQGSDNTNQNNNQHEETKDQEDTQEYSGQSHRNNGDK
ALTNTSNTLTMD