Identifiers and Description

Gene Model Identifier

Contig18266.0.g54

Standard Name

LPIN1a

Aliases

Contig18266_0_g54

Description

LNS2 (Lipin/Ned1/Smp2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08235 ) LNS2 (Lipin/Ned1/Smp2)
  • ( pfam04571 ) lipin, N-terminal conserved region
  • ( pfam12710 ) haloacid dehalogenase-like hydrolase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001892701.0001267035975107e-72lipin, putative
SGDYMR165C3.9989468726312675e-65PAH1 SGDID:S000004775, Chr XII
I from 592628-590040, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18266.0.g54(coding)
ATGGCAACTTTGAGTGGTTGCATTGATATCATAGTAGTGAGACAGCCTGACGGTACACTT
AAATGTTCTCCCTTTCATGTTAGATTTGGCAAGCTTAAAGTGCTTAAATCTTTCGATAAA
GAGGTATTAGTGCAAATTAATGGGGAGGACACGCCTATAAAAATGAAACTAGGTTCTGCC
GGTGAGGCTTTATTCTTGCACTTGAAAAGAGGAATTAACAAAAATTAAGACAATGAATCA
AGGTCATCATACTTTGATGGTTAATCTAGCAGTGGAAGCAGTAGCTCAAGAAGCAATGAT
GAAGAATAAAAGTCTGGCAATTTTGCTAGTTATAAATCCTAGAAAAGCTTTGATTCTCAT
AAATATCTGCCCTAACCACAGACATTCATTAGAGACTATTAATCCTCGAATTAGTAGTCG
ATACATCCTGCTTTAAACTAAGGACTAAAACCCGAAGACAAAAAAATGATTCAGGAAGAG
GAAAAGAAAGACTACGAAGATGACTCAGTGAATTTGAAGTTGCTTCAGATGTCCCCAGAA
ACCATTCAGAAGACTGTGGAGTAGCAAGTGATAAACGAGTATGGTAAGGAAAACATGAGT
CCGAGTTAGCTCTGCAAGAAACCCTTTGAGCCTTTAAACAATCAGCCATCAATAGACAAT
CAAGATGGAAACCTAATTGATGATGAAAACATTGATGGTGAAGTGGCCGATGAAGACACA
AACTTCAAAAAGATTTAAGTTCGAACTCTCAGAAAAATCAAGTCCTTCTCTCTCAGGAGT
CTCAATAAGGACCAAAGAGAGCTGAAAAAATAGTAGAGCATGAAATAGGTGACTTAAGCA
CCCTAGAAATAAGAAGAAAAGTACTATTATGAGAAGAGTATCTATCCCACCTCAGAATAG
CTAGAGAGTTTTAAATTAAAACCAGGGATTAATTAGATTAGTTACATAGTCTAGTCTCGC
ATTCAAGGGAAATAAACTGTAAAAGGAAGAGTGTTCTTGTGGAATTACGACACAAAAATA
ATCATCTCTGATGTAGATGGTACTATCACACGTAGTGACTTAATGGGACATATATTACCT
AGGATGGGCAGAGATTGGTCTCATCAAGGCATTGCCAGATTATTCAATCAAATCAAGGAT
AATGGATATGAAATATTATATCTCACAGCTAGGAATATTGGCTTGGCTGAAACTACTAGG
GACTACCTGAATGGAATCCTGCAGGATTCTTAATATAAACTGCCAGATGGGCCAATTATT
ATGAGTCCAGATAGAGCTATGAAATCTTTAAAACGAGAAATCATATTTAGAAAGCCTCAT
GTGTTCAAGATATTCACACTGAAGATCATAAAAGATTTATTTAAGCATGAACGTAACCCA
TTTATCGGAGGTTTTGGTAACAGAGACACAGATGCAGTATCTTACAGAGCTGTGGACATT
GACTTGAGTAACATTTTCATAGTGAATCCTCAAGGAGAAATCCATCATTACAACTCAGCC
TACAAGAAAACGTATACATTATTGTAAGAATTGGTGCATGACATGTTCCCAAGAATACAA
ACTATTAGCATATAATAGAATATCTCAATTACTCAATAGACTGTCAGAGATAGTCAAGGT
CGATAACACGAAGAGACTAAGATCCAAACTAACAAGGAGATCACCACTAAGACCACTCAA
TTTGTACAAGTTCACAGATGA


>Contig18266.0.g54(protein)
MATLSGCIDIIVVRQPDGTLKCSPFHVRFGKLKVLKSFDKEVLVQINGEDTPIKMKLGSA
GEALFLHLKRGINKNQDNESRSSYFDGQSSSGSSSSRSNDEEQKSGNFASYKSQKSFDSH
KYLPQPQTFIRDYQSSNQQSIHPALNQGLKPEDKKMIQEEEKKDYEDDSVNLKLLQMSPE
TIQKTVEQQVINEYGKENMSPSQLCKKPFEPLNNQPSIDNQDGNLIDDENIDGEVADEDT
NFKKIQVRTLRKIKSFSLRSLNKDQRELKKQQSMKQVTQAPQKQEEKYYYEKSIYPTSEQ
LESFKLKPGINQISYIVQSRIQGKQTVKGRVFLWNYDTKIIISDVDGTITRSDLMGHILP
RMGRDWSHQGIARLFNQIKDNGYEILYLTARNIGLAETTRDYLNGILQDSQYKLPDGPII
MSPDRAMKSLKREIIFRKPHVFKIFTLKIIKDLFKHERNPFIGGFGNRDTDAVSYRAVDI
DLSNIFIVNPQGEIHHYNSAYKKTYTLLQELVHDMFPRIQTISIQQNISITQQTVRDSQG
RQHEETKIQTNKEITTKTTQFVQVHR