Identifiers and Description

Gene Model Identifier

Contig18732.0.g32

Standard Name

LIN28

Aliases

Contig18732_0_g32

Description

Zinc knuckle

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002798200.00000000000020009182674645818Glutathione peroxidase family
protein
SGDYDL175C0.0000000029989608248573072AIR2 SGDID:S000002334, Chr IV
from 145518-144484, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18732.0.g32(coding)
ATGAGTACCAATAGTAGCAATGGCAGCAGCTCAGGCGGCAAAGACAATGCCAATGGCTCT
GGGAAGCAGAAACCAGCTAAACAATAAAGTTAATAAAAACAGGGGCAGACAAAGCCAAAA
AGCTAGCAGTAGATTTAGAAGTGGTCAGATGACGACAGTTCTGATGACTCTCTCACTAAG
TTTTACAAGCAGAGAACCTCAAAATACACATAAGAAGCTTCACAAGTTGGGGGAAACGAT
AGCAAGATGATTAAGACAAATGAGTCAACGAGGAAAGTTGTAGAGACTAAAGTTAATGGG
GCTACCAATGTCATCAGTCAACCAGCTAACGTCAATGCCAAGAGTGAAATTAGCAGTAAT
GAAATTAATAAGACCTAATCTAAGGATCAACAACAACAACAACTCAATCAATCATCAGCT
AATATGATGCAGTAGTAGAATTCGATAGCAGAGCGCACTTAAATGCTATATCGTCAGTAA
ATGTCATTTTAACGACCTAGTGGAAATAGAGAAGTGACAATTACTAACGAATACAATTAG
AGCAATTAATCAGATAGCTTCAAGATTAATAAAGAGAGGGTACCATTGGAACAGATGCAG
AAGTAGTTTGGTCTAGGTGAAGACTAAGAAAGTTTCAAGTTAAATCTCGAAAATCAGAGA
GACTAAGAGTAGCAATCGCTAAGCATGACTTCATTTTTGTTTACTGAAAATAAGCGCAAA
GAAAAAGGTATCAATGAGTTCAATAGTTTGCAGGAAGCATTAGAAAAATTGAATTCTGAT
TCTGATTCAAACTCAAAGCCCATAAAACCAACATTGCAGCTCAACAGTAATGGAAGTTAG
TTGAAGTATGCTTAAAATGCTGAAGAATTGGCTAGAGGAGGATAGATGAAGAAGTAACAG
TCTTAAATGTACATTTCAGCCTTAAATACTCGAAGAAATCCTGATTTGATTTTGCCAGGC
GGGATGTTTTTGAAAGGAAATTTGTATTTCAAGCAAACTTTAGAAGAGGTAGAAGCTAAG
TAAAAGGCAGATTAGGAGTTGTAAGACGAATTAGATTTAGATGAATAGAATGGAGTAGAG
CAATAAGATGGCTTGTTAGTTGAAGATGACGGCGATGATGCCTTTTAAAAGATGAAGAAT
TAAACGACTAGATATTTCATCGAGAACAACCCTACTATTAAATGCAGAAACTGTTTAGAA
TATGGACATATAGCGAGAGAATGCACTAATAAAACTAAGAGACCAAACTGCATTTTATGT
GGCAAAGATACTCATGATTCTTTTAGTTGCAATGAGAAATCATGCTTTAAATGCAATAAG
ATTGGGCATTTGGCAAGCTAATGTACAGAAAGGAATGTCACAAGGTGTAATCGTTGTGAT
CTAGTAGGGCACAAAGAGGCAAGATGTCTTAAAGTGTGGAAAGGTAACTACAACGATTCA
CAAATGTCTCTGTTGAGGTGTATATAATGTGGTTCTAAAGGCCATCTTAAGTGTCTGAAA
GAAAAGACAAGCATGAAAATTCACATTGATTTCTCTATGAAGAACAATTTAGACGAATTC
CTGGATAAGAGAAGGACAATAGAGAAAACTGACAGGCAGAGATCAGAAAGATTTTCATTT
GACTATGCTGATCAGTTTGAGGAAGAGACTTCTAAAATGCTTGATAACACCAATATCGTA
GTTGACACTAAAAAGAAACTGGGAGCCTTGAAAGAGAGTACATTCGGAATACCAAAGAAT
CATGATCCTAAAGATCTATATTGCTGCTACTGTGCAGATAGACACCACGAAAAAGACTGT
AATAAAAATTACTCCACTGGTAATCTAAGATATTAATAATACGAAAGAGTTAGATCAAAG
CTCAATAATTAAGCTCTGGATGACCAGTATGGCGGTGGTGGTGGCTATCAAAGATAAAAC
ACTGGCAGTAATTACCATGTTAGGCTGGCTGCTGATCCTAGAAGAGGAGGAAATTAGTAT
AAAAGTTATGATTAGGATAGTCAGGAGAGCTATGAAGAAGAGTACTATGACTAAAAAAAG
AAGCAAAAATAGTCCTCAACGAATAATAAGAAAAAGCACTCTCGCAAGTACGAAGATTCA
AGTGACAGTGGTTCTAAAGAATCGAGAAGTTACAGCAATGACAGTAAATCTTATCACAGT
GACGACGACTCCGATAGAGTGCTGACTAGCTTCAACAAGATTCTGAACAAAAGTTAAAGT
TTCCAGGTCAAAGATAGAAACAAGATTCCCAAGGGTTCAGCCAAGTACGAAGCAGACTAC
GACGAGGAGGATGAAGATGAAGATTCACAGGGTAACTATATAGATTTAAGCAAGTAGGAT
TATGAAAGAGCTCGCTACAAGAACGGCAAACAGATATACTACGGTAAGAAACAAGGCGGA
GGTAGTGGCAATAACTATGATAGATCTAAGTCGAGGGAGTACTCACACAATTATCAGCGC
AGCTAATCTAATAAAAACTATGGCAGCTATGGTGGAGGAAACTATGGAGGTGGTTACTAA
GGCAAACAGAACTATAATAATAACAACAATAACTATGGTGGTAATAGTGGGTATAATAAG
GCTAGCTATGGTAGCAGCAGATACAGATGA


>Contig18732.0.g32(protein)
MSTNSSNGSSSGGKDNANGSGKQKPAKQQSQQKQGQTKPKSQQQIQKWSDDDSSDDSLTK
FYKQRTSKYTQEASQVGGNDSKMIKTNESTRKVVETKVNGATNVISQPANVNAKSEISSN
EINKTQSKDQQQQQLNQSSANMMQQQNSIAERTQMLYRQQMSFQRPSGNREVTITNEYNQ
SNQSDSFKINKERVPLEQMQKQFGLGEDQESFKLNLENQRDQEQQSLSMTSFLFTENKRK
EKGINEFNSLQEALEKLNSDSDSNSKPIKPTLQLNSNGSQLKYAQNAEELARGGQMKKQQ
SQMYISALNTRRNPDLILPGGMFLKGNLYFKQTLEEVEAKQKADQELQDELDLDEQNGVE
QQDGLLVEDDGDDAFQKMKNQTTRYFIENNPTIKCRNCLEYGHIARECTNKTKRPNCILC
GKDTHDSFSCNEKSCFKCNKIGHLASQCTERNVTRCNRCDLVGHKEARCLKVWKGNYNDS
QMSLLRCIQCGSKGHLKCLKEKTSMKIHIDFSMKNNLDEFLDKRRTIEKTDRQRSERFSF
DYADQFEEETSKMLDNTNIVVDTKKKLGALKESTFGIPKNHDPKDLYCCYCADRHHEKDC
NKNYSTGNLRYQQYERVRSKLNNQALDDQYGGGGGYQRQNTGSNYHVRLAADPRRGGNQY
KSYDQDSQESYEEEYYDQKKKQKQSSTNNKKKHSRKYEDSSDSGSKESRSYSNDSKSYHS
DDDSDRVLTSFNKILNKSQSFQVKDRNKIPKGSAKYEADYDEEDEDEDSQGNYIDLSKQD
YERARYKNGKQIYYGKKQGGGSGNNYDRSKSREYSHNYQRSQSNKNYGSYGGGNYGGGYQ
GKQNYNNNNNNYGGNSGYNKASYGSSRYR