Identifiers and Description

Gene Model Identifier

Contig887.1.g61

Standard Name

LIG1a

Aliases

Contig887_1_g61

Description

ATP dependent DNA ligase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01068 ) ATP dependent DNA ligase domain
  • ( pfam04675 ) DNA ligase N terminus
  • ( pfam04679 ) ATP dependent DNA ligase C terminal region
  • ( pfam01331 ) mRNA capping enzyme, catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003481709.997093137033517e-262DNA ligase I
SGDYDL164C7.002925050786358e-139CDC9 SGDID:S000002323, Chr IV
from 167254-164987, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig887.1.g61(coding)
ATGAAACAATCACAGCTTAATTTTGGCTCTAAAGCTAAAAACAATGATCCAAAAGCCTCC
CAGTAAAAGGGCGCTTAACAAGCTAAGCTTAGCTTTGGAAATGCAGGGTAACTTGGAATA
AAGAAAGTAGTGCAAGAATAAGTTATTTTACCTACAGATGAGAAGCTAAACGATACCAAA
ATTATGGTGACTGCTCAGTAAGAACCCACCTAAGCAATTCAAAAAGTAGAAGAAGTTGCA
TCTATCAAGTAAACACTTCCCAAGACTTCATAAGAAGATGATGTTAAAGAGAACATTACT
ACTAACTCAAAAAAGAGAAGAGTGTGTACTGTTGATGACGATTGTGAGGAAGATATACCT
GTAGTTAAAAGCTCAGCTAAGAAGCAAAGGTTAAATGATGGTACATCAGCTTCAGTTTCA
CTAGTACCACCTCCTCAGAAACTTAATACTGATCATAAAAGTCCCGCTAAAATTGAAAAC
AAAGCTTCACCTTAAGTTAAAAGTCAAGAAGAAACAAAGCAAATCGAACAAAATTTCCCA
CCCAAGGACTTGAGCAGTCTAAGAGCCCCTTCATCACTATCTTACAATCCCATCGAAGAC
GCTCCTTTTCACAAAGGTCAAGCAGTTCCTTTTGGCTTTATTGCTAGGGCTTTAAGTGAA
ATCGAAATTTGTAAAGGTAAAAATAGTAAAGATGCTATTAAAGAAATTGTTGCAAATATA
TTCAGAAGTACTATGCTACTTTCTCCACATGAAACAGCTGATCTATTTTATTTCTTCTGT
GTTAAATTAGGGCCAGACTACGATTCACCAGAAACTGGTATAGGTCTTGAACTATTGTCA
AATGCTGTGGCTAAAGCCTGTGGAAAATCTTTGAAGCAGATAAGAGAACAATTCAAGCAA
GATGGTGATTATGGTATTGTGGTTGAGAAAGGCAAGGGAGTACAAAAATCTTTAGGAACT
TTTTTCAAAAAGTAGGATGAAGCAAAGAAAGCTCCTCTTACATTTAGAACTGTATTTTAA
GCTTTCCTCAAGATTGGTAGAACATCTGGAAATAACTCATAAACCGAGAAAGAGCAAATA
ATTCTCAAACTATTACAAGATGCTACAAACGAAGAAGCTAAGTATATTGTGAGATGGTTG
CAAAAGAACTTGAAAACTGGAGCTGCTGAGAAAACTTTCATTTCTGCTTTAGCAAGAGCT
ATTGTATACACTCCACCAAACAGCAAGGGTAAAGTTCTTAACTCTAAAAAGATTCTTGGA
GAAGCCTAATTTGCAGAAAAGTGTGCTCAAATAGAAATGGGAATAGGAGAAGCGATTTGT
GAATTCCCCAACTATGGTTTGATTATTGAAACACTTCTTGAAGTTGGTGATGATATGGTT
AAACTTAAGGAGAAATGTCATATTACTGTTGGTATTCCTGTAAAGCCTATGCTCGCTAAG
CCAACTAAAGGTATCAGAGAGGTCCTAGATAGATTTGAACAAGTTAAATTCACTTGTGAA
TACAAGTATGATGGCTTCAGGGGATAAATTCATTTCAATAGAAACGATCCAATCAATAAA
GTAAAGATTTACTCCAGAAATTTGGAAGATATGACAGGTCAATATCCTGATATTGTCGAC
TTTGTATCATAATCACCAAATGAAGGAGTTGATAATTACATATTGGACAGTGAACTGGTT
GCCTTCGATCATGTTAACAACAGAATCTTACCTTTCCAAACTCTCACTCAGAGAAGCAGA
AAGAATGTGACTGAAGAAGACTTGAAAACAAGGATTTGCATTTGTGCCTTTGATCTTCTG
TATCTTAACGGTCAATCTTTGTTAAAGGAACCTTTTATTAAAAGAAGAGAAATATTGCAT
TAAAACCTGCATGAAGTTCAGAATAGTTTCGTCTTTGCCAAATTCAAGGATGCTGAAGCC
ATCGAGGCTATCGAGGAATTCCTTGCTGATTCAATCAAAGACTCTTGCGAAGGACTCATG
ATTAAAACTTTAGATACAAACGCTACTTATGAGCCTTCAAAGAGATCACTTAACTGGTTG
AAACTTAAGAAAGATTACATAGACACAGGTCTAGGAGATAGTTTAGATCTAGTAGTTGTA
GGAGCTGATTTTGGCAAAGGAAAAAGAACAGGTATGTATGGTTCATTCTTGTTGGCTTGC
TATGATGAAAATCTTGAAGTACTTCAAACAGTAACCAAAATGGCAACTGGTCTCTCAGAT
GAAATGCTTGCTAAAATCTATGAGCAACTCAAGGATCTAGAAATCAACAAGCCTCCCTCA
AACCTTAAATATAAAGAAAAGAACGTTGATGTGTGGATCATGCCAAAGTATGTTTGGGAG
ATTAAATGCGCAGATTTGTCAATCTCCCCAGTATATTGTGCTTCAATTGGATCAGTAGAA
CCCAATAGAGGTATTGCACTAAGATTCCCTAGATTTATCAGAGAAAGAGATGATAAGTAA
GTTGAAGATGCCACATCCAGTGAACAAATTCTTGAGTACTATAAAAGTCAACCATCTCTT
CTTAAAAACGATGATGACGATGAATTTGACTTCTGA


>Contig887.1.g61(protein)
MKQSQLNFGSKAKNNDPKASQQKGAQQAKLSFGNAGQLGIKKVVQEQVILPTDEKLNDTK
IMVTAQQEPTQAIQKVEEVASIKQTLPKTSQEDDVKENITTNSKKRRVCTVDDDCEEDIP
VVKSSAKKQRLNDGTSASVSLVPPPQKLNTDHKSPAKIENKASPQVKSQEETKQIEQNFP
PKDLSSLRAPSSLSYNPIEDAPFHKGQAVPFGFIARALSEIEICKGKNSKDAIKEIVANI
FRSTMLLSPHETADLFYFFCVKLGPDYDSPETGIGLELLSNAVAKACGKSLKQIREQFKQ
DGDYGIVVEKGKGVQKSLGTFFKKQDEAKKAPLTFRTVFQAFLKIGRTSGNNSQTEKEQI
ILKLLQDATNEEAKYIVRWLQKNLKTGAAEKTFISALARAIVYTPPNSKGKVLNSKKILG
EAQFAEKCAQIEMGIGEAICEFPNYGLIIETLLEVGDDMVKLKEKCHITVGIPVKPMLAK
PTKGIREVLDRFEQVKFTCEYKYDGFRGQIHFNRNDPINKVKIYSRNLEDMTGQYPDIVD
FVSQSPNEGVDNYILDSELVAFDHVNNRILPFQTLTQRSRKNVTEEDLKTRICICAFDLL
YLNGQSLLKEPFIKRREILHQNLHEVQNSFVFAKFKDAEAIEAIEEFLADSIKDSCEGLM
IKTLDTNATYEPSKRSLNWLKLKKDYIDTGLGDSLDLVVVGADFGKGKRTGMYGSFLLAC
YDENLEVLQTVTKMATGLSDEMLAKIYEQLKDLEINKPPSNLKYKEKNVDVWIMPKYVWE
IKCADLSISPVYCASIGSVEPNRGIALRFPRFIRERDDKQVEDATSSEQILEYYKSQPSL
LKNDDDDEFDF