Identifiers and Description

Gene Model Identifier

Contig8073.0.g76

Standard Name

LIDd

Aliases

Contig8073_0_g76

Description

jmjN domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004555009.004296568159186e-20jmjC domain containing protein
SGDYJR119C0.0000020007268868677913JHD2 SGDID:S000003880, Chr X f
rom 646490-644304, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8073.0.g76(coding)
ATGTAAAACACAACAAACATAACTAACAAAACTGGCAGCTCTACCACTTTGAAAAAAAGA
GGTAGACCTTCGACTAAAAATATTCAGGGCCTAAGTCAAATACTACCTGAAGAAGCTGAG
AAAGCGTATAATGTGAATTGCATAGATAAATTAAATTCTGAAAAAATGTCTATTTTTAAT
GATCTTGATCAAAAGTTGCCTTAAAAAAGAATTTGTGCAGATCAAATGGATAAAATGCAA
GCTAAATTAGAAAATTTGGCTAAGTCTGATAACTCTTCATCAACCGATGCGAATATTCAT
ACTAGTCCCTCAACCCCCTCGTTGAAATCAGGTATTCATGATGAAAGTAGTGATAATCAA
AGGATCGCTTCTCAATTGCATGACAATTAAATCTCTAAAAGAGTAGCAAAATCCACTAAA
AAGTAGAATGGGAATCACTCGTATTGCAATAGAAAATAAAAACTGATAAATATTCTAGAA
GATTATGATGAGGATCAAGAAAATGAGGACAACTAAAATAACTAGTCATCAAATAATGGT
GGATAGAATACCAATAAATTGAGAGACTTCGATAATTTGATCACCACTGAGGAGGAGCGA
ATGATAAAATTGGCAATCAAAAACTCCATGGCTGAAATTCAAAACTCGAATGCGGATCTG
GATTAAATCGAGGAGATGTAAACTTTTTATCCCACAGACTTAGAATTTCAAAACCCTATG
ATCTACATAGAAAAATTGGTCAAAGAGGGAGCTGAAAAATTTGGAGTAATTAAGATAGTT
CCACCCAAGACATTCCAGCCTTCCCTCGCATTTGATATTTTTTCAGATAAGAAGCTGCCG
ACTAGATATTAAATATTATAAGAACTCTCTCAAGGAAAGCCATTCAACTAAAACTAAGCA
GGGTATACCTTCTAGGAATTTGTGAAGAGATCTCAAGAATTGGAGATTAATGATCAAAAT
CCAGACTATAAATAAATCGAGAGAGACTATTGGAATTTTGTAGAGAATTAAGTAGGGCCA
GAAATGAAGATCACCCCTGGAACCTGA


>Contig8073.0.g76(protein)
MQNTTNITNKTGSSTTLKKRGRPSTKNIQGLSQILPEEAEKAYNVNCIDKLNSEKMSIFN
DLDQKLPQKRICADQMDKMQAKLENLAKSDNSSSTDANIHTSPSTPSLKSGIHDESSDNQ
RIASQLHDNQISKRVAKSTKKQNGNHSYCNRKQKLINILEDYDEDQENEDNQNNQSSNNG
GQNTNKLRDFDNLITTEEERMIKLAIKNSMAEIQNSNADLDQIEEMQTFYPTDLEFQNPM
IYIEKLVKEGAEKFGVIKIVPPKTFQPSLAFDIFSDKKLPTRYQILQELSQGKPFNQNQA
GYTFQEFVKRSQELEINDQNPDYKQIERDYWNFVENQVGPEMKITPGT