Identifiers and Description

Gene Model Identifier

Contig5905.0.1.g58

Standard Name

LIDc

Aliases

Contig5905_0_1_g58

Description

JmjC domain, hydroxylase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004555001.999129405549486e-73jmjC domain containing protein
SGDYJR119C1.9991939848149086e-44JHD2 SGDID:S000003880, Chr X f
rom 646490-644304, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5905.0.1.g58(coding)
ATGTAAAACACAACAAACATAACTAACAAAACTGACAGCTCTACCATTTTGAAAAAAAGA
GGTAGACCCCCAACTAAAAATATTCAAGGCCTAAGTCAAATATTACCTGAAGAAGCTGAG
AAAGCGTATAATGTGAATTGCATCGATAAATTAAATTCTGAAAAAATGTCTATTTTTTAT
GATCTTGATCAAAAGTTGCCTTAAAAAAGAATTTGTATAGATCAAATGGATAAAATGCAA
GCTTAATTAGAAAAATTGGCTAAGTCTGATAACTCTTCATCAACCGATGCGAATATTCAT
ACTAGTCCCTCAACCCCCTCGTTGAAATCAGGTATTCATGATGAAAGTAGTGATAATCAA
AAGATCGCTTCTCAATCTGCATGTCTCGAAGAAGAGAAAAAATTAAAATCTAAATGTTAG
GACACTTAAATCTCTAAAAGAGTAGCAAAATCCATTAAAAAGCAGAATGGGAATCGCTCG
TATTGCAATAGAAAATCAAAACTGATAAATATTCTAGAAGATTATGATGAGGATCAAGAA
AATGAGGACAACTAAAATAACTAGTCATCAAATAATGGTGGATAGAATACCAAGTAAGAA
ATAAGAAGAACTCAAAGACATGCACCCCCGAGTAAATTGAGAGACTTCGATAATTTGATC
ACCACTGAGGAGGAGCGAATGATAAAATTGGCAATCAAAAACTCCATGGCTGAAATTCAA
AACTCGAATGCGGATCTGGATTAAATCGAGGAGATGTAAACTTATTATCCCTCAGACTTA
GAATTTCAAAACCCCATGATCTACATAGAAAAATTGGTCAAAGAGGGAGCTGAAAAATTT
GGAGTTATTAAAATAGTTCCACCCAAGACTTTCCAGCCATCCCTCGCATTTGATATTTTT
TCCGAGAAAAAGCTGCCGACTAGATATTAAATATTATAAGAACTCTCTCAAGGAAAGCCA
TTCAACTAAAACTAAGCAGGGTATACCTTCTAGGAATTTGTGAAGAGATCTCAAGAATTG
GAGATTAATGATCAAAATCCAGACTATAAATAAATCGAGAGAGACTATTGGAATTTTGTA
GAGAATTAAGTAGGGCCAGAAATGAAGGTTGAATATGCTGCTGATTTACCTACTTAGACT
TTCGGATCTGCCTTCGGTCGCCATGGCCAAAAGATTTATGACAAAAAAGCAGAAAAATAA
TTAGATCACCCCTGGAACCTGAACAACTTTTATAAGCAAAAAGACTCGCTTTTGCAATTT
CCAAACAAAAAAGATATCTCAGGAATCAGTACTCCCTGGCTTTACATTGGTATGAAATAC
TCCACATTTTGCTGGCACTTTGAAGATCTTATGCTCTACTCTATTAATTATAATCATTGG
GGGAAGCCCAAACTTTGGTATGGAGTACCAAGCACTGACCGAGAAAAATTTGAGAAAGCT
GTCAAATAGAAAGTTGCACTACTTTTCAAGAAAGACCCTAACATTTTACTTGACATAATT
ACAATGATATCACCTGCATATCTAGTCAAGAATAAGGTAAAAGTGTATAAAACCCTGTAG
ATGCCTGGCGAGTTCATCCTGACATTCCCGGGTGCCTATCACTCTGGATTCTCGACTGGG
TTGAATATTGGGGAGGCAGTCAATTTCGTGACTAGGAGTTGGATCCCTTAAGGACTCAAG
TGCTAGTAGATATATAGAAAAAGCAGGGAAAAAATTCCTGTATTCCCTATTGACTGGCTT
ATTATCGAAAACATCAGAAGTGTCTCTCAGATAGATTTGGAGTATGAAAGTTTACTAAAA
CTGAAGGAAACCTACAAAGACATCCTAGAGCAAGAATTAGCAGTGCAACTACTAAATATC
TTGAATAATAATGACAGCCAAGAAAACAGCTAAAGAAATTTCTCAGTTGGAGGAATAGTA
CACTAAGTAAAGAGGAAGTTCTATTAGATGATGAGTAATAGAGATTAAGTTGCGGAGGAT
GAGCATTAGTGTCAATATTGCACGGATTTCACATACATTTCTATGATTAAGTGCTCAATC
CATAATTTCACATACTGCCTCCAGCATCAACTAATGTGCGGCTGCCCTGTACCTAGTCTC
TCCATTATTTATAGGTATTCCACTTTGGAATTGATATAATTCTACCACCAAATCAAGAAT
GCTTGCAAGACTTCCAAGCTTCTTCAACAACAGTAACTTGAATAAGACTCAGGGAATAAC
GAGATGAAAGATTTTAAGTCAGTCTAGGCTTAACAACAATCGCTATTTCCCTTAACTATT
TAAGCCTCCAACCCTTAAATAGGTGCCATTTCAACATCAGTCCTTCATATGTAATAAGAT
AGTTAAATAGCTGAAGCCAAGGTTGAACAACAATTGAAAGAAGAAACTGATCAATCAAAG
CCCAAAATAACGAGAAAATATAATTCAATAACTAGGAAATTAAAGAAAAAAACTAATGAA
ATTGAGGAGGAAAAAACAGTTCAAGCTGAACCATCAGGATTTAAAATGTATCAAGCGTTG
ATCATGAAGCTACAAGTATGA


>Contig5905.0.1.g58(protein)
MQNTTNITNKTDSSTILKKRGRPPTKNIQGLSQILPEEAEKAYNVNCIDKLNSEKMSIFY
DLDQKLPQKRICIDQMDKMQAQLEKLAKSDNSSSTDANIHTSPSTPSLKSGIHDESSDNQ
KIASQSACLEEEKKLKSKCQDTQISKRVAKSIKKQNGNRSYCNRKSKLINILEDYDEDQE
NEDNQNNQSSNNGGQNTKQEIRRTQRHAPPSKLRDFDNLITTEEERMIKLAIKNSMAEIQ
NSNADLDQIEEMQTYYPSDLEFQNPMIYIEKLVKEGAEKFGVIKIVPPKTFQPSLAFDIF
SEKKLPTRYQILQELSQGKPFNQNQAGYTFQEFVKRSQELEINDQNPDYKQIERDYWNFV
ENQVGPEMKVEYAADLPTQTFGSAFGRHGQKIYDKKAEKQLDHPWNLNNFYKQKDSLLQF
PNKKDISGISTPWLYIGMKYSTFCWHFEDLMLYSINYNHWGKPKLWYGVPSTDREKFEKA
VKQKVALLFKKDPNILLDIITMISPAYLVKNKVKVYKTLQMPGEFILTFPGAYHSGFSTG
LNIGEAVNFVTRSWIPQGLKCQQIYRKSREKIPVFPIDWLIIENIRSVSQIDLEYESLLK
LKETYKDILEQELAVQLLNILNNNDSQENSQRNFSVGGIVHQVKRKFYQMMSNRDQVAED
EHQCQYCTDFTYISMIKCSIHNFTYCLQHQLMCGCPVPSLSIIYRYSTLELIQFYHQIKN
ACKTSKLLQQQQLEQDSGNNEMKDFKSVQAQQQSLFPLTIQASNPQIGAISTSVLHMQQD
SQIAEAKVEQQLKEETDQSKPKITRKYNSITRKLKKKTNEIEEEKTVQAEPSGFKMYQAL
IMKLQV