Identifiers and Description

Gene Model Identifier

Contig16165.0.1.g65

Standard Name

LIDa

Aliases

Contig16165_0_1_g65

Description

JmjC domain, hydroxylase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004555006.002203762674495e-72jmjC domain containing protein
SGDYJR119C5.998439611888618e-47JHD2 SGDID:S000003880, Chr X f
rom 646490-644304, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16165.0.1.g65(coding)
ATGAATCCATAGCCACCAGCAACCCTAATGCCAAAATTTGTAGATGGCCTGTCCCAATAG
ATGCCCCTCATTGAGGCCTCTCAAGACTCAGAAGCCAAGCTCCAGAGTGAGTACTCCCTC
AGACACTCGGCCGAGTTCTGTTCCTAAAATAGCGATCCTATGAAGCGCAGGAGGGTCGAT
ACACTCGCAACTGAGGCCCAAAGCCCTAAAAATTCACAAATTACTTAAAATAAGACAATA
AAAACTCTCTCTTAAGAAAGCCTAACTCCCAGTTAAAATGGATTAAATCATTAAACAAAG
ATCAATATATTAAGTGAGAAGGATTGTGTGAAACTGGAGAAACTAAGAGACTCAGATTCA
ACAAATGACAGCAAGGACCTTGAAAAAATTGAGTAACCTCTTTCCTAGATAGGGAAGCAG
CCACTCATTGATTTAGAGGAGGAAAAAGAAAGCCCAAAGAAGAGGGGCCGGAAAATTGGT
CGGGGTAAAGAGCTATTAGACCTTTAAGAATAATTAAAAACTTTAGACACAGATGAAGAA
TAGATTGAACTTATTTCCACCATAAAACAAGATGACTAAAAACTGAGAATGGATAGTAGC
ACCTAAGATTGCTCTACACAAATGAGGAGATCACGAAGGCAGATTATGCCTCAGAAATTC
AAAAACACATATTTAGATTAAACAATGACAGCATAGGAGGAAAAAATGATCAAAATGGCA
ATTAAAAATTCCATTATTGAGCAAGAAAGCAAAGTAACTGAGTAGCTTGATGACATTTAA
GAAATGAAAGTTTACTACCCAACTGAGCAAGAATTTAAAAACCCAATCACTTATATTGAG
CAGTTATTCAAGTTAGGTGCTTCTAAATATGGCGTTGTCAAGATTGTACCACCAAAAGAT
TTCAAACCTGTGCTAGCTTTCGATTAATTCTCCGATTAAGTACTTCCATCGAGGTTTCAG
GTGCTTTAAGACCTTGCTTAAGGAAAGCCATTTAATCAAAACCTAAACGGTCACACATTC
CCAGAGTTCGCTTAGATAAGCAAAAAGCTTGAACAGGAAACTGCCACCCCAGATGCCGAC
CCACATGACTACTGGGAGGTAGAGAAAGAATATTGGAATTATGTTGAGAATCAAGTTGGG
CCAAGATAAAAAGTCGAGTATGCAGCTGATTTAAATGTGCTACAGTTTGGGTCTGCATTT
GGAAGACCAAACTAAAGTGTTATGGATAAACGTGGGCTGCAGTATGTCGATCACCCTTGG
AACCTGAATAATATGTTCAAATAACCAGGGTCTTTGATGCAATTCCCAAGATCTAAGGAT
ATCTCAGGTATCAACATTCCTTGGTTGTATATTGGCATGAAATACTCAACCTTCTGCTGG
CACTTCGAAGATTTAATGTTATACTCAATCAACTACAATCACTGGGGTAAGGCTAAGTTA
TGGTATGGTGTTCCAGAGACTGATAGAGAAAAATTTGAAAAAGCTGTCAAAACTAAAGTC
GCTCTACTTTTCAAGAAAGACCCAAATCTTTTAATGGATATTGTTACTATGGTCTCTCCA
CACTATTTAGTTCAATAAAAAGTAAAAGTATATAAGACTTTACAGATGCCTGGTGAGTTT
GTCTTAACATTCCCAGGTGCCTATCATGCTGGTTTTTCAACTGGTTTAAACATCGGGGAA
GCAGTAAATTTCGTTTCTAAGTCTTGGTTTGACTATGGCTTTAAATGCTAGGAAATTTAT
AGAAAAAGTAGAGAAAAAATTCCAGTTTTCCCAGTAGATTGGCTTTTAGTCGAAAATATA
TCCAATATTGATAAAGTAGCCTTAGATTTAGAGACAAAAACTAAGTTACGAGATGTTTAT
GTGAAACTATTTAGAGAAGAACGAAAACAAAGAGAAATACTTGAGAAAACCCTAAAAGCC
TGTAATTAAGCTCATGGTTCTAATAACAATAGCAAGCCAGTCTATGAAATGATGGGAAAT
AGGGAGCATATAGCAGAAGACTCGCATTAATGTAGTTATTGCACCGATTTCGCATATTTA
AGCATTATTTATTGCACTAGGCATAAGACCAATTCATGTCTCAACCATCAAATTATTTGT
GGGTGTAGCCCATAGAGCATAAAACTGATATACCGCTATTCAACTAAAGAACTCGAAAAG
TTTGATAAAATGATAAAAGACTCGGTTGCTAATCATAGTGACTAGGAAGAAGAATAGAAA
TTTAGAAATAATTGTAACAAACATCACTAGAATTTTATAAAACCATTGGAAAATTAAGAT
ATGGTGGATCTAAAAAACACTTCAAAAATGACGAGAATGAGTGTGGGAAAAAGCACGCCA
AGTAATCCCACTTCAAAGCAAAAAGACGAAGGTAAAATCAAAAGTTCATAAGACAAAAGT
TCAAAAATATAATCAAATAGCAAATAATAAAATAAATCCAAAAGCAAATAGGATAAAGAG
GAAGACATGGAGATTACAGAGGATGAGATAGAATGA


>Contig16165.0.1.g65(protein)
MNPQPPATLMPKFVDGLSQQMPLIEASQDSEAKLQSEYSLRHSAEFCSQNSDPMKRRRVD
TLATEAQSPKNSQITQNKTIKTLSQESLTPSQNGLNHQTKINILSEKDCVKLEKLRDSDS
TNDSKDLEKIEQPLSQIGKQPLIDLEEEKESPKKRGRKIGRGKELLDLQEQLKTLDTDEE
QIELISTIKQDDQKLRMDSSTQDCSTQMRRSRRQIMPQKFKNTYLDQTMTAQEEKMIKMA
IKNSIIEQESKVTEQLDDIQEMKVYYPTEQEFKNPITYIEQLFKLGASKYGVVKIVPPKD
FKPVLAFDQFSDQVLPSRFQVLQDLAQGKPFNQNLNGHTFPEFAQISKKLEQETATPDAD
PHDYWEVEKEYWNYVENQVGPRQKVEYAADLNVLQFGSAFGRPNQSVMDKRGLQYVDHPW
NLNNMFKQPGSLMQFPRSKDISGINIPWLYIGMKYSTFCWHFEDLMLYSINYNHWGKAKL
WYGVPETDREKFEKAVKTKVALLFKKDPNLLMDIVTMVSPHYLVQQKVKVYKTLQMPGEF
VLTFPGAYHAGFSTGLNIGEAVNFVSKSWFDYGFKCQEIYRKSREKIPVFPVDWLLVENI
SNIDKVALDLETKTKLRDVYVKLFREERKQREILEKTLKACNQAHGSNNNSKPVYEMMGN
REHIAEDSHQCSYCTDFAYLSIIYCTRHKTNSCLNHQIICGCSPQSIKLIYRYSTKELEK
FDKMIKDSVANHSDQEEEQKFRNNCNKHHQNFIKPLENQDMVDLKNTSKMTRMSVGKSTP
SNPTSKQKDEGKIKSSQDKSSKIQSNSKQQNKSKSKQDKEEDMEITEDEIE