Identifiers and Description

Gene Model Identifier

Contig579.1.g57

Standard Name

LARSb

Aliases

Contig579_1_g57

Description

tRNA synthetases class I (I, L, M and V)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006703409.997093137033517e-262leucyl-tRNA synthetase family
protein
SGDYPL160W9.997093137033517e-262CDC60 SGDID:S000006081, Chr XV
I from 246990-250262, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig579.1.g57(coding)
ATGGAATCTACAAAGCAACAACTATAGGGCGAAGACAAAGCCACCAGTCGCAAGAGATAC
GATCACTTGCGTGCTATCGAGAGACAAATGAATGAGGAGCACCTTACATCAAGATAGGCT
GAGGGAACACCTCTTGCTAATTACGAGCAACTCTCAACTTAAGAGAAAAACCAAGGCAAA
TATTTCACTACATTCCCATATCCATACATGAACGGCTACTTGCATCTTGGTCATGCATTC
TCACTTTCAAAGTGTGAATTTTCAGTCAGATATCAGAAACAGCTCGGCAAAAATGTTCTC
TTCCCATTCTCCTTCCATTGCACAGGTATGCCAATATAAGCAGCTGCATTTAGACTCAAG
AGAGAAATCGATAGTGGAAACACTCGCAATCCACCATTCGTTGTTGACAAGGCTAATCCC
AAAGCTGAACCACCAAAGCCAACTCAATACGAAATTCTCTTGTCTTTGGACATTGAAGAG
AGTGAGATTCCTAAATTTATGGATCCTGAATATTGGCTTCACTATTTCCCACCCCATGGT
ATGCAAGACTTGAAAGACTTGGGTATTTATGCTGACTGGCGTCGTTCTTTTATCACTACT
GAAGTAAATCCATTCTACGATTCTTTCATCAGATGGCAATTCGATACCTTGAAGAAGTCT
GATAAAGTCCGTTTTGGAAACAGACCAACTGTTTTCTCAGAAATCGATAACTAACCATGT
GCTGATCACGATAGATCAAAGGGAGAAGGTGTTGGTCCACAAGAATATACTCTTATTAAG
ATTAAATGCCTTGAGTTGCCAGCTTCCATGCAAGAGCAATTTGCAGGCAAAAATGTTTAC
TTGGTAGCTGCCACCTTGAGACCAGAGACTATGTACGGTTAAACCAACTGCTACGTTTTG
CCAGATGGTGAATATGGAGTATTCGAAATGATCAATGATGAATACTTTGTTTGCTCACAA
AGATCTGCTAGAAACATGTCCTTCCAAAACATGACTAAGGAGGCAAAGAAATATCCATGC
TTGTAAAAGGTTACTGGATAAGAACTCATTGGATTGAAATTGAAAGCACCTTTGACTAAG
TACGAACACGTTTATGCTCTACCTATGCTCACCATTTCCATGACAAAAGGTACTGGTATT
GTTACTTCAGTTCCATCTGACTCCCCAGACGATTGGGCTGCTCTTAGAGATTTGATTAAC
AAGAAACCATTGAGAGAAAAATACAATGTTGCTGATGAGATGGTTCTCCCATTTGAGCCA
GTTCCAATTATTGAAATCCCAGAGTTCGGTAACTTGGCAGCTGTTAAACTTGTAGAAGAC
ATGAAAATTCAATCTTAAAACGACAAAGTGAAACTTGCTGAAGCTAAGGATAAAGTATAC
TTGAAAGGATTTAACGAGGGAGTTATGCTCATTGGTATTGGTGAAAACATGAAAGTTAAG
GATGCCAAGCCAATAGTTAGAAAGCAATTGCTTGATAACAATGAAGCTGCTATCTATTTT
GAACCTGAAAATGAAGTTGTCTCAAGGTCTGGAGAAGATTGCGTAGTCGCTCTCTGTGAC
TAATGGTTCTTGACCTACGGTGAAGAAAGCTGGAAAGAACAAGTTAAGGAACATGTCAAA
TCACCAAACTTTAACGCTTATAACCCAAAAACCCAACAAGAATTCGAAGAGACTCTTGAA
TGGCTTAAGGAATGGGCTTGCTCAAGATCAAAGGGTCTTGGTACTAGACTCCCTTGGGAC
ACTCAGTTCTTGATTGAATCACTCTCAGATTCCACTATTTATATGGCTTACTACACTGTA
TCACATCTCCTTTAAGGAAACATTAATGGCTCAGAGGGTGGTCCTCTTGGCATTAACGCA
CAAGACTTGACTGATGAAGCTTGGGAATACGTATTCAAAAAGGGTGCTTACCCAGATGGT
TGCAAAATTCCAGAAGAGCATTTGAAGCAAATGAGAAACGAATTTGAATACTGGTACCCA
CTTGACATGAGAGCATCAGGCAAGGATTTGATCAGAAATCACTTGACCATGGCTTTGTAC
AATCATGCTGCTGTATGGGAATCTAAAGATATGATGCCAAGAAGTTTCTTCTGTAATGGT
TGGATCCTCGTAAACTCCAAGAAGATGTCAAAGAGCGAAGGTAACTTCAGAACAGTAAGA
CAGTGCCTTGAAATGTACGGTGTTGATGCCACCAGAGTAGCACTCGCAGATGCAGGTGAT
AGCTTGGAAGACGCTAACTTCGACGAAATGGTTGCTAACTCAGCCATTCTTAGACTTTTC
GTACTGGAAAAGTGGATTAGTGAGGAGCTTAAGAAGCATGTCCCAGCTGAAGGATTGGAC
TTCAGCAAGCAACCTGAACTTGACTTGTGGGACCAAATTCTTGACAATGAACTTAACTAT
GCTGTTGAGCAAACTACCAACAGTTACAATGAAATGAGATTCAAGCAAGCTCTCAAGCAC
GGTTTCTTCGAGTTGTCAAATTTGAAGGAGGACTACTTGATTGCTAAACACGGCAACGTC
AACCCATTCCTCTTGATGAAGTATATCGAGACTCAGCTCATCCTCATTAACCCAATAACC
CCTCACTTCGCTGAGTACTGCTACAAGAACCATGTCTTGCCAATTCTCTAGAAATCAGTT
AACCTCCCCAAACCAGCTCAAGAGAAACTGTTGGATCAGGGCTGGCCCAGTCCCAGCAAG
GCATTCGATGCTGGTAAGCTTAGAAGAGTTTACGACTACATGCGTCATGTTAAGAGTACA
GTTAGAATGAATATGGAGAAAGCCAAGCATGGCGGAAAGAAGGGAGCTAAGGCTGCAGCT
AAAGGAAAGAAGCCAGCAGATGGACAAGCCGAAGAAAAAGGAGTTGAGAACTGCGCTTTG
TTCGTAGCTCTTGAGTACCCAGAATGGCAAAAGGCTGTTCTTGAGACTCTCCACTCTTTC
GAATTCAAGGACAACAAGATCTAAGGAAACTACATTAACGCTGTTAAGGAGAAAGTTGTT
GGACCCAAGCAAGGATTCGCTCTTAAATTCGCTGCTTTCCTTGCTAAGGAAGCTGAGACA
GTTGGTAAAGACCAAGCACTTGAAATTAAAACTCCCTTCGACGAAGTTGAAATTATTGAC
ACTAACAGACAATTCTTGTTCGAGAACATGCCAGGCATTAATAACATCAACGTTTACCAA
GTCAACACCGAAACTGAGATCCCCAACTCCCAGCAAACCAGAGAGGCTTCTCAACCAGGA
AAGCCCTCTTCCATGTTCTTCTGA


>Contig579.1.g57(protein)
MESTKQQLQGEDKATSRKRYDHLRAIERQMNEEHLTSRQAEGTPLANYEQLSTQEKNQGK
YFTTFPYPYMNGYLHLGHAFSLSKCEFSVRYQKQLGKNVLFPFSFHCTGMPIQAAAFRLK
REIDSGNTRNPPFVVDKANPKAEPPKPTQYEILLSLDIEESEIPKFMDPEYWLHYFPPHG
MQDLKDLGIYADWRRSFITTEVNPFYDSFIRWQFDTLKKSDKVRFGNRPTVFSEIDNQPC
ADHDRSKGEGVGPQEYTLIKIKCLELPASMQEQFAGKNVYLVAATLRPETMYGQTNCYVL
PDGEYGVFEMINDEYFVCSQRSARNMSFQNMTKEAKKYPCLQKVTGQELIGLKLKAPLTK
YEHVYALPMLTISMTKGTGIVTSVPSDSPDDWAALRDLINKKPLREKYNVADEMVLPFEP
VPIIEIPEFGNLAAVKLVEDMKIQSQNDKVKLAEAKDKVYLKGFNEGVMLIGIGENMKVK
DAKPIVRKQLLDNNEAAIYFEPENEVVSRSGEDCVVALCDQWFLTYGEESWKEQVKEHVK
SPNFNAYNPKTQQEFEETLEWLKEWACSRSKGLGTRLPWDTQFLIESLSDSTIYMAYYTV
SHLLQGNINGSEGGPLGINAQDLTDEAWEYVFKKGAYPDGCKIPEEHLKQMRNEFEYWYP
LDMRASGKDLIRNHLTMALYNHAAVWESKDMMPRSFFCNGWILVNSKKMSKSEGNFRTVR
QCLEMYGVDATRVALADAGDSLEDANFDEMVANSAILRLFVLEKWISEELKKHVPAEGLD
FSKQPELDLWDQILDNELNYAVEQTTNSYNEMRFKQALKHGFFELSNLKEDYLIAKHGNV
NPFLLMKYIETQLILINPITPHFAEYCYKNHVLPILQKSVNLPKPAQEKLLDQGWPSPSK
AFDAGKLRRVYDYMRHVKSTVRMNMEKAKHGGKKGAKAAAKGKKPADGQAEEKGVENCAL
FVALEYPEWQKAVLETLHSFEFKDNKIQGNYINAVKEKVVGPKQGFALKFAAFLAKEAET
VGKDQALEIKTPFDEVEIIDTNRQFLFENMPGINNINVYQVNTETEIPNSQQTREASQPG
KPSSMFF