Identifiers and Description

Gene Model Identifier

Contig2732.0.g1

Standard Name

LARS2

Aliases

Contig2732_0_g1

Description

tRNA synthetases class I (I, L, M and V)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam13603 ) Leucyl-tRNA synthetase, Domain 2
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam01921 ) tRNA synthetases class I (K)
  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam00750 ) tRNA synthetases class I (R)
  • ( pfam00749 ) tRNA synthetases class I (E and Q), catalytic domain
  • ( pfam02780 ) Transketolase, C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005322209.997093137033517e-262leucyl-tRNA synthetase family
protein
SGDYLR382C9.997093137033517e-262NAM2 SGDID:S000004374, Chr XII
from 884751-882067, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2732.0.g1(coding)
ATGATCACGAATTTATTAAAATCATAATGGAAAAAGTTAAGTTGTCGGCAAAATCAAAAC
CATCTAGGAAAGTTTAGATAAATTATTGACTTTGGTTAGACAAGAAACTTCTCTTATAAC
TTTTAGAAAGTTGACAAATTTTGGTAATAGAAATGGGAACAAGAAAACCAATCAAAAATT
GTTAACGAATAAGAATCTAACTCTCAAGATTAAAAATAGAAGAAGTATATTTTAGGCCAA
TTCCCTTACCCCTCAGGAAATTTACATATGGGTCATGTCAGAGTTTACACAATTTGTGAT
GCTCTAGCTAGATACTATAAATAAAAAGGTTTAAGAGTAATCAATCCCATGGGTTGGGAT
TCTTTTGGTTTACCAGCTGAAAACGCCGCAATAAGTCGAGGTATAAATCCTGAAATATGG
ACAAACTAGAATATACAAGAAATGAAAGAACAGCTGAACAGATTGGGATTCGATTTTGAT
TGGGACAAAGAACTTGCCACTCACACCCCTGAGTACTATAAATTTACGTAGAAAATATTT
TTGGATTTGTATGAGAAAGGTCTGGCATATCGCAAAGATGCTTATGTGAACTGGGATCCA
GTTGATCAGACAGTTTTAGCTAATGAGTAGATTGATGCAAATGGTTGCTCTTGGAGGTCT
GGAGCTAAAGTGGAAAAGAAACTTATGAAACAGTGGTTTTTTAAAATTAGACATTACGCA
AGCGCGATGCAGAGAGATCTCTAACATCTCTCGAAATGGCCAGACACAGTGAAAGAAATA
TAACGAGGTTGGATTGGTGAAAGCTAAGGGGCCAACATTAAATTCAATCTTAGACTCTAA
AACGATGAAGAACTACCTCTGACTATCTTTACAACAAGACCTGACACTATATATGGTGTC
ACTTTCCTAGCACTTGCTTATGATAACCCACTAGTTTAACAGTATCTACTCAAAAACAAC
GCGATAGATCAAAACGCTTATGATAGATATTTAGATCGTTTGGAAACTCTGAAGGCAAAG
GGAAAAGATTTAAAGTAAATAGACTTGAATGATATTGATGAGGGCATTAAATTGAGCAAT
GTTAAAGCAGTTCATCCATTGACAGGAGAAGAAATACCAGTTTATCTTACTTCATATGTT
TTAAGCGACTATGGAACTGGAGCTATTATGGGTGTACCATTTCATGATGATAGAGATTGC
TGTTTTGCAGTTAAAAATAACATCAACATGATTTAAGTAGTAACTGGAGATGAAGAAAAT
GATCTAGACAACTGCTAGATGTCAAATAGTTAAGAATTCAGTGGGCTAAATAGAAAAGAA
GCTTTGTAAAGGATTATTGATAAAATTGAAAGCATGAATGTAGGTAAAGCTACTTATGAA
TACAGAATGAGAGATTGGCTAGTTAGTAGACAAAGATACTGGGGAGCTCCTATTCCTATA
ATTTTATGCGATTCATGTGGGGAATAGACTGTAGCTGAGAAAGACCTCCCTGTTTTACTA
CCTAAAATAGGGGAAAGCTCTATTAACCTGAAATAAAGCTAACCTCTCGGAAGCGTTGAA
ACTTTCGTAAATTGCAAATGTCCAAAATGTGGAGGGAATGCTAAAAGAGAAGTAGATACT
CTCGATACATTTGTTGATTCATCATGGTACTTTATGAGATTCTTGGATAGCTAAAACATA
AATCATATATGTGAAGAAACCAAAAGAACTTCATGGATGCCAGTTGATGTTTATGTAGGA
GGTATGGAACATGCTATTATGCACTTGCTTTATGCTAGGTTCATTTACAAGTTCATAGAT
GAGTCAAGGAGGAATGGCCAAGAAAGATAGCTCATAGATGGCCATCCTCAAGATGAGCCC
TTCAAAGAGTTAGTAGTTTAAGGCCTCGTTAAGGGTAAAACTTACAAGCTAAAATCAAAT
GGCAAATACATTTTCAGAGAGGACGTACCAAATTTCAAAGAAGAGGATCTCATAGTTACT
TTCGAAAAGATGTCTAAGTCTAAGGGTAATGGAATCCTCCCTGATGATATTGCTTCAAAA
TATGGAGTTGATACATTAAGATTAGCATTGATGTTTGCTGCTCCACCAGAAAGTGATGTG
AATTTTGATGAGAATTTCATCACCTCAATGAAAGATTATCTAGATAGAGTAAACAGATTA
TCTGAGTATGTCACAAGTTAAGGTGATATCAAAATTTCGAATAAAACTGAAATTTAACAC
AAATATAAAAAAGAATTGATAGAAATTTACAAGCTAATGAGTGACTATGTGATTAAGATT
GAAGATCAGAGATTTTTCCATGTTTCAATTGCCAGATTAATGGAACTTACTAATCGTTTG
CAGAAATTGAGATAATTGAGTGATGAGGGTAGCTAATAAGTGCTTGCAGTTGGGCTCGTG
TACCTCATTTAAGGTTTATATCCCTTCGCTCCACATTTAACTTCTGATATTTGGTAAGAA
TTAGAGACAAAATCAAGGCTAATCACTTAACTAGGACTCAACCCAATTTTCAATTAAAAT
ACTCTGGATGACTTCAAAACTCTCCTTTAAGAGGCAGACACAAAAGTGAAGCTAAAAATC
TCACTTGATAATTAAATGCTTGGGGAAATAGAGGTATCTAAAGACCTGCAAGGAGACCCA
CAGAAAATATTGGAGTATATAATCTAGGAGAAACCTGCAAATTTAAAGAAAATTGAGAAA
TTCTTTAACAAAACTAAAGTTGAAGATTATGAGAAAATAGTCGCACCATAGAACAAACCA
ATTATAAGTTTTGTTTCTAAAAAGTGA


>Contig2732.0.g1(protein)
MITNLLKSQWKKLSCRQNQNHLGKFRQIIDFGQTRNFSYNFQKVDKFWQQKWEQENQSKI
VNEQESNSQDQKQKKYILGQFPYPSGNLHMGHVRVYTICDALARYYKQKGLRVINPMGWD
SFGLPAENAAISRGINPEIWTNQNIQEMKEQLNRLGFDFDWDKELATHTPEYYKFTQKIF
LDLYEKGLAYRKDAYVNWDPVDQTVLANEQIDANGCSWRSGAKVEKKLMKQWFFKIRHYA
SAMQRDLQHLSKWPDTVKEIQRGWIGESQGANIKFNLRLQNDEELPLTIFTTRPDTIYGV
TFLALAYDNPLVQQYLLKNNAIDQNAYDRYLDRLETLKAKGKDLKQIDLNDIDEGIKLSN
VKAVHPLTGEEIPVYLTSYVLSDYGTGAIMGVPFHDDRDCCFAVKNNINMIQVVTGDEEN
DLDNCQMSNSQEFSGLNRKEALQRIIDKIESMNVGKATYEYRMRDWLVSRQRYWGAPIPI
ILCDSCGEQTVAEKDLPVLLPKIGESSINLKQSQPLGSVETFVNCKCPKCGGNAKREVDT
LDTFVDSSWYFMRFLDSQNINHICEETKRTSWMPVDVYVGGMEHAIMHLLYARFIYKFID
ESRRNGQERQLIDGHPQDEPFKELVVQGLVKGKTYKLKSNGKYIFREDVPNFKEEDLIVT
FEKMSKSKGNGILPDDIASKYGVDTLRLALMFAAPPESDVNFDENFITSMKDYLDRVNRL
SEYVTSQGDIKISNKTEIQHKYKKELIEIYKLMSDYVIKIEDQRFFHVSIARLMELTNRL
QKLRQLSDEGSQQVLAVGLVYLIQGLYPFAPHLTSDIWQELETKSRLITQLGLNPIFNQN
TLDDFKTLLQEADTKVKLKISLDNQMLGEIEVSKDLQGDPQKILEYIIQEKPANLKKIEK
FFNKTKVEDYEKIVAPQNKPIISFVSKK