Identifiers and Description

Gene Model Identifier

Contig20424.0.g76

Standard Name

LARP6

Aliases

Contig20424_0_g76

Description

Protein of unknown function (DUF3223)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring phosphorus-containing groups (IEA) | GO:0016772

Biological Process

  • tRNA splicing, via endonucleolytic cleavage and ligation (IEA) | GO:0006388

Domains

  • ( pfam11523 ) Protein of unknown function (DUF3223)
  • ( pfam05383 ) La domain
  • ( pfam01885 ) RNA 2'-phosphotransferase, Tpt1 / KptA family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003848603.0011931572567413e-53La domain containing protein
SGDYDL051W0.0000000010002658722841845LHP1 SGDID:S000002209, Chr IV
from 363952-364779, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20424.0.g76(coding)
ATGGTTTCATCAACTGCTGATATTAAAAAGCAAATCGAGTACTACTTGTCCGATAGCAAC
TTGTCTCACGATAGATACTTCCACGATAAAATTGAAAGCAACCCAGAGGGCTGGTTAGAC
ATCGCTGAGATTTTGAATTGCAATAAAATCAAGAAGATGAAGATCACTGAAAAGCAAATC
GCTGATTCCATAAATGCAGGCGCTTCAGAACTCGTAGAGGTCAGTGCTGATGGCAAGAGA
GTTAGAAGACTCGGTCAGAAGGCTCTTCCAGAGTTAACCAAGAAGGGAGAAGACGGTTTG
AGAAAGAGAGATGCCAAAGCCGCTGGAAAAGAAGAAGAAAAGGAAGGAGCTGATGATGGC
CTTGTATAATATGACGAAAAGGGATATCCCATCCTAGTCAACCAAGATTTCGAAAACGCA
GTCATTGTTCACTTCAAGACTCAACCAAAGGAAGCAGGAGATCTCTTCAAAGTAAACTGG
AAAGAAATCGAGAATGAAGTCAAGTAAAAGCACCCAACTTTAAAGATTGTCTACTCTAGA
GCAGATTAATTCGAAGGAGATCTCGCCATTTCATCTTACAAACTTAAGCAACCAAATCTC
GATAAGCTCTTAGAGTCTAGTATTAAGGTTCAAGATAGAAACTTTGTCCTTACCAAGACT
GCTGGGGAGGAGTTGAAGGACTTCTGGCAAAAGCAAGGTGGTCACTATCAATTCTGTATC
TAACCCAAACTTAGAAATATCAAGAAGTAATAAAAGGCCTTAAAGTTAGCCAAGAGAGAA
GGTGGTGCCTCCAAGGACAACGGAGATGGTTCAAAGAGACCCAAGCTCAGTTTTGAAATT
GCTGGTTAATACTATACCGATATCAGCAAGGTAAAGTCAAAGGGAAGAGCAATCCTTAAC
TTGAAGAAGGACGGAGAGAAATTGACAGGCAATGATGAGGAATTCATTAAGGAAATCATC
CAATATCACGATAAAGCTGAGGCTAAGATGAGAGATTTCAGTCATTTTGAGGCTGGTGAA
CACCCAAGTTACGAAAAGACCAGATGTTTCTTCGTTGTAAGAAAGGATGGCGCCAAAGAA
GACTTCAGCATGAGCAAGTGTATCATGAATTTAGATAAATAATCCGCACAAGCAGAATGA


>Contig20424.0.g76(protein)
MVSSTADIKKQIEYYLSDSNLSHDRYFHDKIESNPEGWLDIAEILNCNKIKKMKITEKQI
ADSINAGASELVEVSADGKRVRRLGQKALPELTKKGEDGLRKRDAKAAGKEEEKEGADDG
LVQYDEKGYPILVNQDFENAVIVHFKTQPKEAGDLFKVNWKEIENEVKQKHPTLKIVYSR
ADQFEGDLAISSYKLKQPNLDKLLESSIKVQDRNFVLTKTAGEELKDFWQKQGGHYQFCI
QPKLRNIKKQQKALKLAKREGGASKDNGDGSKRPKLSFEIAGQYYTDISKVKSKGRAILN
LKKDGEKLTGNDEEFIKEIIQYHDKAEAKMRDFSHFEAGEHPSYEKTRCFFVVRKDGAKE
DFSMSKCIMNLDKQSAQAE