Identifiers and Description

Gene Model Identifier

Contig3250.0.g43

Standard Name

KPNB1c

Aliases

Contig3250_0_g43

Description

Importin-beta N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03810 ) Importin-beta N-terminal domain
  • ( pfam00521 ) DNA gyrase/topoisomerase IV, subunit A

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR347C2.99915080840225e-45KAP95 SGDID:S000004339, Chr XI
I from 826413-823828, Gen...
T. thermophilaTTHERM_000131100.00000000000008999700526206354hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3250.0.g43(coding)
ATGGATTTTGAAAGATATCAGGAGTTTTCCTCCCTTTTGCACGCCCACTTCAGTTCCAGA
GATAACGCAGAAAGAAAGAATGTTGAAGCTTAAATCAAGCAACTTAAAATAAGAGATGAG
TTAAAATTCTTATAAGCATGCGTTGCAGAATTGATAGACACCTCAAACGATCCTTAGGCA
ATTCAACTTGCTTCAATTTTGTTCAAGAACACATTGATTAGCAAGGATGATATCAATGCA
CATTTATGGGAAAGACAAGACCCCTAGAAACGTGCTTTTATCAAGGAGAAACTTTTTGAG
ATAATCTCAGCAAACGTTCATCCCCAATTTTCAAAGAGTGGAGCTACTTGTATTGCAGCT
ATCGCATAAATTGAGATTCCAACAAGATCTTGGCCTGAACTTCTTCCATTACTATCTTAA
ATGGCATTTCAAGATAATCCACCAGCTGTTAGATTCGGTTCACTTTAAGCAATCGGATTT
ATTTGTGAAGACGTTGATCCTGAATACTTCACGAAAGATGAGCTTAACAATATTTTTGGG
GTTCTACTGCAAAATGTAGACACAGTCAATATCGAGCTTACTCAAATAACAATGAAAGCT
TTTGCTAGAGCAGCTTACTTGACAAAGTCCTGCTTTGAAAGTGACCCTCATAGGCATTAC
GTTATGAATCAGTTGTTCCTTGCTGGAAGCATTAATGATGAGGAAATCTAGAGTTCATCA
ATGGAAGCTCTAAATGATATCGCAAGAGAAAGCTATGATTTTATGAGAGAGTACATACCT
AAAATTGGAGAATTGACTTCAAATCTTTTACAATCAGAGTATGAGTAAGGAGCTAAATTA
GCAATCGAAGTCTGGGCAACTATTGCAGAAGTTGAAGCTAAAAGAGAGCAGTAAAATGAA
GCACATAGTTCGATAATCAGGGATTACTCTTCTCAAATTATTGGTATTGTACTAACTGCT
TTGGCAAAGCAAGATATTGATAGTATGGACGAGTAATCAGATGAGTTGCCTTAATAAAAT
AGCTCATACAATGCTGCATCTGCTATAGAAGCTATGGCAAGAATCTTGAAAGATGATATC
TTGGATCCTGTATTTGACTTCATCAAAGATAGATTTGCCAGCGACATTTGGGTTAACAGG
TTTGTTTCAATGCTTGCATTTGCAAGTATAATTGAAGGACCAAGCACTGACCGAATCATT
TAAGTAGTATCAGTTGCTTATACCAATATTATGAGTATGATAGATGACTCAGCACTTCTT
GTAAGAATAATGATGGGCTCGGTCTATTAAAAGATAGCTACAGTAGTACCTCAAATAATT
CTTGAGATCCCAGAGAATCTTGATCTATTCACATCTAAGGTCCAAAATCATTTGGTTGAT
AACTTTAAAGTTGCACTCGCTATGATTGCCAGTTTGAGGAATCTGTTTAATTCAGCAAAT
TTGATAGGAAAATCAGAACTACTTAATTCAGCATTGAATAATACTCTCCCAGTTATATAT
AGAATGATTTTCTAATAAGAGGTCATTGTTTAAAATGAACTTTAGTCTGTTGCTGATTCG
ATAATTGACATAATTGACGATTGCGATTTCTAATCGAATGCAGGATTCCTTTGGGATCTA
CAAACTAACATTCTTGATGAGCTGAATAAAACCTTAACTCCTGAAACCTGCTCTGTCAAT
TTGCTTGGAGAGAGACTAGAACACTTCTAAAACATGCTAGGAAGTATCATTGATTAACTC
ATTTATAAGTTTAAACACAACTTAAACGGTGATTTTGTGCAAAATGTATTGAACTTAGTC
ATATCTATTTTCAACTAGCATTAAAAGGTAACATCAGGTGGATGTGTTATGATTCATGGA
CTTATGGTAGGTTCAGAGAAAAACTTTCTCCCCTTCGTAAATTAGGTGAAATAGTATATA
ATTTCAGGTATGCTATAGACTTAAGATCCCTGGATTAGTACAGTATCATGCGGTCTAATT
AGCGATTTTGCTGCAAATTTAGAGTTAGACTTTAGTCAATTTGCAGAAGAATTTATGCGT
CCTCTTTTCATACTATTGTAAGGAAGCGAGTACAATCTTGAGTCTAAATCAAAAGGATTA
ATTGCAGTTGGAGATACCTGTTTAGCTATCGACCAAAATTTCATACCATTCTATGAAAAA
ACTCTTGAATGTATCATGGCAGCAGCAACTCAATCATTTGAGCCAATTTTTGAAAATCAA
ACTTAACTCATCGAATTGCAAAGTTCAATTTTAGATTGCTTTAACTCATTGCTGCATGGC
ATGGAACCTGCTACTTAGAATCAAAACATGAGAGCCAAAAATCATGATTTAAGCAAAAGG
GTTCTTTTCTTTATGGACACATACATTGACAAGGCTCCTCATATCCATGATGAACAATAA
AAGCTCATCTATGATATGTATACAGACATTCTGTCAATGTACGGCTAGGATATGTAAGAA
TTCTTTGTTAGACTGCCACTCACGAGAAAGCTCCTAGAAAATGTTGACAGAGTAAAATTT
GACGACAAGCAAGATACTGTTGAGAGATTCTATCAATTTATCAATTAATTTTAAATTGCA
GTTTGA


>Contig3250.0.g43(protein)
MDFERYQEFSSLLHAHFSSRDNAERKNVEAQIKQLKIRDELKFLQACVAELIDTSNDPQA
IQLASILFKNTLISKDDINAHLWERQDPQKRAFIKEKLFEIISANVHPQFSKSGATCIAA
IAQIEIPTRSWPELLPLLSQMAFQDNPPAVRFGSLQAIGFICEDVDPEYFTKDELNNIFG
VLLQNVDTVNIELTQITMKAFARAAYLTKSCFESDPHRHYVMNQLFLAGSINDEEIQSSS
MEALNDIARESYDFMREYIPKIGELTSNLLQSEYEQGAKLAIEVWATIAEVEAKREQQNE
AHSSIIRDYSSQIIGIVLTALAKQDIDSMDEQSDELPQQNSSYNAASAIEAMARILKDDI
LDPVFDFIKDRFASDIWVNRFVSMLAFASIIEGPSTDRIIQVVSVAYTNIMSMIDDSALL
VRIMMGSVYQKIATVVPQIILEIPENLDLFTSKVQNHLVDNFKVALAMIASLRNLFNSAN
LIGKSELLNSALNNTLPVIYRMIFQQEVIVQNELQSVADSIIDIIDDCDFQSNAGFLWDL
QTNILDELNKTLTPETCSVNLLGERLEHFQNMLGSIIDQLIYKFKHNLNGDFVQNVLNLV
ISIFNQHQKVTSGGCVMIHGLMVGSEKNFLPFVNQVKQYIISGMLQTQDPWISTVSCGLI
SDFAANLELDFSQFAEEFMRPLFILLQGSEYNLESKSKGLIAVGDTCLAIDQNFIPFYEK
TLECIMAAATQSFEPIFENQTQLIELQSSILDCFNSLLHGMEPATQNQNMRAKNHDLSKR
VLFFMDTYIDKAPHIHDEQQKLIYDMYTDILSMYGQDMQEFFVRLPLTRKLLENVDRVKF
DDKQDTVERFYQFINQFQIAV