Identifiers and Description

Gene Model Identifier

Contig9585.0.g36

Standard Name

KPNB1b

Aliases

Contig9585_0_g36

Description

HEAT repeats

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR347C3.000745802558524e-63KAP95 SGDID:S000004339, Chr XI
I from 826413-823828, Gen...
T. thermophilaTTHERM_000131109.998397555368434e-52hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9585.0.g36(coding)
ATGGAATTCTTTCATGAACTCAAACCCAACCTTGCAGCCACTCAAGGAAACAGTAACGAA
GCAAGAAAAGCTGCAGAAGTAGAAATTAGAAGGTTACGCGATCAAGATCCTAGGAAATTC
GTTGCAACATTGACCATGGAAATTGCTGATGTATCAAACACTGACAAAGTTAGAATGGTT
GCAGCCTTGGTATTTAAAAATTTCATTTCTTCTGGCAGATCTCAAGACCCAAGATACGAA
GATTTCTGGATAAATTTGGATAGAGAGTTTAAAGATAATATTAAAGATGCCTTGCTAGCT
TGTTTAGTCACGCCTTCAAGTGTGGTTCGCAGACAAATTGCAAGTGCAATTGCATCTATA
GCTGCTATTGAAATTCCAAGAGGGGAGTGGCTTGATATTATTGGCAACTTATCTAATAAC
AGTGCTCATGAGCAAATTGAAATTAGACATGCATCTATTGAGACTCTAGGATTTGTGTGT
GAAGAGCTAGTACCAGATGATTTGAACAATGAATTGAAGAGTTTAGTGATTCAAGCCCTA
ACTCGTAATATAATTGCAGATCCTCTATTGGAAGGTACAACTTTGCTAGCAATAAAGGCC
CTTTACCACGCTCTTCCATTCGCATCACCAAACTTCATGGTAGTGCACGAGCGTGATTAC
ATCATGGGTAGGATCTTTGAAGCTTTTTCATGCTAAGACGAAGAAATTAGAATCGTTGCT
ATGCAAACTTTGGTTGATATCGGCAGACAAGAATATGAGAGCATCGAGTTTTATTTCAGT
AAAATTTGTGAGATCACTGCTACTTCAGCTAGAAACGATGTTGAAAAAGTTGGAGCTCAA
GCTATCGAGTTCTGGACAAGTTTAGCCGAAGAAGAAGGCCGTAGAATAGCGAAGAGAACT
TACAACAAAGGATACATTGCTCAATGCTACTTTGAACTTGTGAATCTTTTGATTTCATGC
ATCTAGATTGTCAAGATTGAAGATGAAGACGATGACGATGATGAATTGAGTGTATCTTTG
TCTGCTGGCTGTTGCTTAAATGAAATAGCAAAGATTAATGGAGATCAGATACTTGATTAA
GTCATTGGTTTTGTCTCCAAGAATGTTACAAATGAAGACTGGAAATTAAGATATTCCTCA
TTACTTGCACTTGGAGCTATCACTTATGGTCCAGACCGTAATAAATTCTTGAACTAAATC
ATGCCTGGCTTATAAAACTTGATGCAAATGTTTAGCGATCATCATGGTAAAGTCAGAGAA
GCTATTTCATGGGTTTTCTCAAAGATTTGTGAGAACCATAGCGATGTTATTGCAAATAAG
GACGTCCTAGACAATCTCATCCCTATTTTCATTACACATCTCCCAGACAGACCAAGAATT
TCAAATTAAATCTGCAGTTGCTTAGAAAATTTAGCAAAAATGAGTGATAACTACGCCACC
CCAGAAACAACTATTCTCTCGCCATACTTCAAAACTCTATTTAACGCTTTGATGGTTAAT
GCCTATAGAGAAGATAGCGAATAAGGCTCTGTAAATTTGATTTTAGCAAGCTTTACAGCA
ATTTCAGATTTATGTGAGCACGCAGCACCTGATCAATACCCAGTTCTCTATGAGATGCTT
ATTCCAGTACTAAAATTACTTGAAGAAACTAACAATGCAGATTAATATGGGGCTAAGAAG
ACCTAAGAGTACTAAGACTATCTTGGAGGTTTGTTACAAGTAATGCTTGCAAAGATTGGA
TCAATGATTGATGATTAAACTGCAAGTAGTATAATTCAGTTGCTTATCACTTTGTTTAAA
TCACAGAATAGAGTTACTGAAAACGGTTTGATTGCTTTCAGTGGACTTTGCAATGGAATT
GGCAGCAGAATCAATATTCAGGATTTCGGTAACTTCTTGGTGTTTGCTCTCAAGGGAGAA
GATGATGAATGTGTTCGCTTAGCCTGTGGTATAGTCTCAGATTTGGCAGGAGCCATGAAG
GAAAACATCAACAACTTCTTAGAGGACTTTGTACCACCAATGATTGACATTCTGAGAAAC
TCAAATCAGGACAGACTATCAAAACTTTCTGCTATTAATGCACTTGGAGATATAGCGATG
AACTCTGGTGAACCATTTGTCAACAGGTATTTGGAAGATGTGCTTAAGATTTTAGAGGGA
GCTGCTAAGCTTAGCTTACAGATGATTACTGAAGATCAAGATCCAGATCTATGCTAATAT
CTGATTAATCTTAGAGAAACTCTCATCGATACCTATACTTATATTGTCCATGGAGTAGAG
CAAAGCAATGTGAAAGATTCTCTAATTCTATATTCATCATCTATTATTGGTTATCTATAA
GAAGTTTTGAACCCAACTCTGAACCCATCAAAGAAACTTATGAAAGATGTTCTTGGATTG
ATTGGAGACTTAGCAAGTTGCATTGGTCCAAGGATTAAAGACTAACTTAGGACACCATTT
ATAGAAAAATTAGTGATGTACATCCAAAATGAGCCAGACCAAGAATCAAAATAAATAGCT
GATTGGACTCTTGAATAAATCAAAACTGCCTTCAGTCAGCTCGGTTGA


>Contig9585.0.g36(protein)
MEFFHELKPNLAATQGNSNEARKAAEVEIRRLRDQDPRKFVATLTMEIADVSNTDKVRMV
AALVFKNFISSGRSQDPRYEDFWINLDREFKDNIKDALLACLVTPSSVVRRQIASAIASI
AAIEIPRGEWLDIIGNLSNNSAHEQIEIRHASIETLGFVCEELVPDDLNNELKSLVIQAL
TRNIIADPLLEGTTLLAIKALYHALPFASPNFMVVHERDYIMGRIFEAFSCQDEEIRIVA
MQTLVDIGRQEYESIEFYFSKICEITATSARNDVEKVGAQAIEFWTSLAEEEGRRIAKRT
YNKGYIAQCYFELVNLLISCIQIVKIEDEDDDDDELSVSLSAGCCLNEIAKINGDQILDQ
VIGFVSKNVTNEDWKLRYSSLLALGAITYGPDRNKFLNQIMPGLQNLMQMFSDHHGKVRE
AISWVFSKICENHSDVIANKDVLDNLIPIFITHLPDRPRISNQICSCLENLAKMSDNYAT
PETTILSPYFKTLFNALMVNAYREDSEQGSVNLILASFTAISDLCEHAAPDQYPVLYEML
IPVLKLLEETNNADQYGAKKTQEYQDYLGGLLQVMLAKIGSMIDDQTASSIIQLLITLFK
SQNRVTENGLIAFSGLCNGIGSRINIQDFGNFLVFALKGEDDECVRLACGIVSDLAGAMK
ENINNFLEDFVPPMIDILRNSNQDRLSKLSAINALGDIAMNSGEPFVNRYLEDVLKILEG
AAKLSLQMITEDQDPDLCQYLINLRETLIDTYTYIVHGVEQSNVKDSLILYSSSIIGYLQ
EVLNPTLNPSKKLMKDVLGLIGDLASCIGPRIKDQLRTPFIEKLVMYIQNEPDQESKQIA
DWTLEQIKTAFSQLG