Identifiers and Description

Gene Model Identifier

Contig15726.0.g39

Standard Name

KPNB1a

Aliases

Contig15726_0_g39

Description

HEAT repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR347C1.9999590304423412e-72KAP95 SGDID:S000004339, Chr XI
I from 826413-823828, Gen...
T. thermophilaTTHERM_000131101.0003503620230312e-57hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15726.0.g39(coding)
ATGGAATTCTACACTGACCTTAAGACTTATTTGGCCGACACACTCAGCATAAGTAAGTAA
ATCAAGTTTTATTTGACTGTTTTTTTAAATGATTTCCCTTTCAAACTGACAATCCTTGCT
TTAGAATAAGATGAAAGAAAGACTGCTGAAGCATAAATCAGAATATACAGAGATTAAGAC
CCTAGAAAATTCCTGGCTTCCCTTACTAAAGAACTTGCTGATGAGACCAACAATGAGAGT
GCCAGGATGACAGCTGCTATCTTAACAAAGAACTTTATTGCAAATAGAGGAGGCGATTAA
AGGTATGAGGATTACTGGGTGAACCTCGATCAAGAATTCAAGGAATAATTGAAAGTTGCA
TTTCTCGCTTGCTTAGCTACAAATTCACTTATAGTTAGGAAATAAGTATCTGGTGTTGTG
GCAATTATTGCAAGCATTGAAATTCCAAGAAAGGAATGGCTAGATTTGATCCCTAACCTA
TCAGCAAACTCTGAGCACGAGTCTTATGACATCAGATATGCTTCACTTGAGACTCTTGGT
TTCATTTGTGAAGAGCTTTCTCCTTCAGACTTGACTCAAGAATTAAAAAATCGTATTGTT
TCAGCACTTGTAAGCAACATCCAGACTGATCAACAGTATACTAAGACCACTAATCTTGCT
GTGAAAGCCCTCTTAAATGCTTTACCCTATGCAACTCACAATTTTTCTATTGAATCAGAT
AGAAACTTCATCATGTAAAAGATTTTCTAAGCAATAAAGAGTCAAGATGAAGATATTCGT
TTCGTTTCTATGCAAATACTTTGTGAGTTTGGAAGATAAGAATACGAGATGGTTCAATAT
CACTTCAAAGAGATATGTGATGCAACTGCTTTATCAGCTAGAAGCGACATTGAGAAGGTT
GGTGCACTAGGAATTGAATTTTGGACATCCTTGGCAGAAGAAGAATAAGCCAGGATTTAA
AAGAACGCTTTTGTAAAAAATTATATTAGCCAGTGCTATTAAGATTTAGTTGCTCTTCTA
GTTGAATGCATCCAAAGAGTGAATATATAAGACGAGGAAGATGAAGATGATGAGTTTGGA
GTAGCTCTGTCATCTGGATGCTGTTTAGGTGCTATTTCAATACTAGTTGGAAATGAAATA
ATGGAGCCAATCTTGGCTTTTGTAAGTCAAAATATATAAAACCCCGACTGGAAGAAAAGA
TATTCCGCCCTTCTTGCTCTTGGAGCAATCACAGAAGGTCCTGATAGGTTGAGATTTATG
AATGTTATTATTCCAGGTCTTCAAAATCTTATTGTTATGTTCCATGATTAAAGCGGGAAA
GTTAGAGAAGCAATTGCATGGGTAATGTCAAAAATTTGTGAGAATCATTCAGATGTCATT
ACTAACTAGCAAGTTTTACCTGGTATTATTCCAATTCTTTTGTAAAGCCTGAAAGATAAA
CCTAGAATTTCATTGTAAGTTTGCAGAGCCATTGAGAATTTGGCAATTTCAACAACCTGC
CAAGAGAATCCTGCAGAAAACTTATTGACACCATATTTTAAGATTATAGTAGACGAACTA
CTCACAAACTCATAAAGAACTGATCATGATTAAAATCAAACAAACCTCTCAGGAGCTAGT
TTTTCAGCTTTACATGCTATTTGTGAGAACGCAGGGACTAACTCAAATAATGAACTGTAT
CAACTTTTGATGCCCACCCTTTAGATGATCGAATAAACTTTGAACCCAGGAACATTCGGA
GAACAAAGAAGTAAAGATTTTCAGGATTATTTATCGGGACTCCTTTAAATCATTTTGGTT
AGAGTTGGATCAAAAGTTGATACCGACACTGCAGCAAATATCGTTAAGCTCTTGGTAATG
ATCTTTAATAATTAAAAGAAAGTTACTGAGAACGGATTGATTGCATTGAGTGGTCTCATA
AATGGAGTAGGTAACAGGCTTGACATAAATGAATTTGGAAAGTATGTCGTATTTGCACTT
AAAGGTAATGATGAAGAGTGTTTGAGACTAGGGTGCGGAATTGTTTCAGATCTAGCAAAC
GCATTCAGAGAGCAGATCGGTTCATATCTATAAGACTTTATCTAGCCTTTAGCAGCTGCT
CTATCAAGCGCAGATTCCTCAAGATAAACTAAACTACAAGCATTGTATGCAATTGGTGAC
TTGGCTATGCACTCTGGAGAAGCTTTCAGCCAACAATATTTATCAGATACACTAATGATA
TTGAGCAGTGCAAGCAAATAAAGTTTAGTAAATGTATCAGAGAGTTAAGATCCTGATCTT
GCATCCTACTTGTAAAGTCTTAGACTTGCAATTGTCGAAACCTACACTACATTATTGCAA
GGGATCGAAGATTAAACTTCATCCTAATATATGATTTAATTCACACCTAGCCTCATGGAG
TATCTCTAATAGCTATCATCAAAGGTTTATAATCCATCATTTGAATTATAAAAAGCTGTA
CTTGGGCTAATTGGAGACTTGGCTGCTGCCTTTGGATCAGCAATAAAGCAATCTTTGAAT
CATCAATTCTTAGAGCAACTAGTTATTGCTGCTTAAAACAGTAATCAACCTGATGCTAAG
GAACTTGCTGGCTGGGCAACTGAGCAGATAAGAAAAGCTATATCATCATGA


>Contig15726.0.g39(protein)
MEFYTDLKTYLADTLSISKQIKFYLTVFLNDFPFKLTILALEQDERKTAEAQIRIYRDQD
PRKFLASLTKELADETNNESARMTAAILTKNFIANRGGDQRYEDYWVNLDQEFKEQLKVA
FLACLATNSLIVRKQVSGVVAIIASIEIPRKEWLDLIPNLSANSEHESYDIRYASLETLG
FICEELSPSDLTQELKNRIVSALVSNIQTDQQYTKTTNLAVKALLNALPYATHNFSIESD
RNFIMQKIFQAIKSQDEDIRFVSMQILCEFGRQEYEMVQYHFKEICDATALSARSDIEKV
GALGIEFWTSLAEEEQARIQKNAFVKNYISQCYQDLVALLVECIQRVNIQDEEDEDDEFG
VALSSGCCLGAISILVGNEIMEPILAFVSQNIQNPDWKKRYSALLALGAITEGPDRLRFM
NVIIPGLQNLIVMFHDQSGKVREAIAWVMSKICENHSDVITNQQVLPGIIPILLQSLKDK
PRISLQVCRAIENLAISTTCQENPAENLLTPYFKIIVDELLTNSQRTDHDQNQTNLSGAS
FSALHAICENAGTNSNNELYQLLMPTLQMIEQTLNPGTFGEQRSKDFQDYLSGLLQIILV
RVGSKVDTDTAANIVKLLVMIFNNQKKVTENGLIALSGLINGVGNRLDINEFGKYVVFAL
KGNDEECLRLGCGIVSDLANAFREQIGSYLQDFIQPLAAALSSADSSRQTKLQALYAIGD
LAMHSGEAFSQQYLSDTLMILSSASKQSLVNVSESQDPDLASYLQSLRLAIVETYTTLLQ
GIEDQTSSQYMIQFTPSLMEYLQQLSSKVYNPSFELQKAVLGLIGDLAAAFGSAIKQSLN
HQFLEQLVIAAQNSNQPDAKELAGWATEQIRKAISS