Identifiers and Description

Gene Model Identifier

Contig17290.0.g12

Standard Name

KOT1

Aliases

Contig17290_0_g12

Description

Glycosyl transferase family 41

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008649900.0000000000000299873730555305TPR Domain containing protein
SGDYBR112C0.00003998524687536623CYC8 SGDID:S000000316, Chr II
from 465770-462870, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17290.0.g12(coding)
ATGTGGACATTTGGGAAAAACAACGACTCGCAGACCAAGCACACTTCAATTTCACATCAA
AATCTACAGTTCAATAATGAGCAGATGATGAATAGCCCCAGGACTGACCGCCTGGAGAAG
TGTCTTATTCGAATTGATGAGTCAAAAAGTGAGGGAAGAAACAGTGATGTGATCAGTACT
TGCCATCAAGCACTGCAAATACTTCAAGATGAGCCATTCGCAGATCAGGAACTCAATCAA
AGCTTCTATTCTAAATTCCATGCGAGATTAGCTCAAGCTCATTTGAGTTTGGGAGATATG
AATAATGCATTTTCAGTGGCAGATTAGTTAATTGGCAGTATAGCTTAATCTCCTTAACTT
ATCTAAGCCAACAAATATCAATTCATAGATGCCTTGATAGTGAAATGTCACATCTTAATC
TAACATAACCAGCTAAATGATGCTGCTTAGTTAATAAGTGAGATTGAAATTCTTCAACCA
AAAACTTAAAATGTGAACACACAAGCATCACTAGCTCATTCTTTCAGTGGCAACTCTATA
CCTTAACCGTAGTTAGGTCATGGAGATTACTTCAAGAATTCATAGAGCATCAGAGGAAAT
AGTATAGATGGGAGTGATGTTTCAGGGTTTGAAAGCATAGAAGAATAAACTGTTAATTTG
GAACTAAGTCTTGTCAAATATGAATTTTTAATTCATTCTGGAAATCAAGAACTTGCTGTT
AATATTCTCTAAGATGCAATATCTTAAGCGTCATAGTCAACGTAGGGCATCCTAAATAAT
TTCCTAATTGACGGTAGATATACCAACCAAAATCGCAGCTTTAATTCATGCTCAATTGAT
GGCAATAGTACATTCAATCATTAAACAGTTCTGCAACTCACTCTGTTTTTCTAATTGATA
GAACGATGTTATCAGAAATTGATGGAAATATAGATTAAGTAATTAACCACGTCATAATAA
TTGGCCATTATACCTAACTCTGCTCAAATTCCATCAAGCCAACAAATTCTAAGTGCAAAT
TAGGACACTTAAGATTCGCAAAGCAAGGAACTTTTATCTTAAAATTAGAAAGAGATTAAC
AAAATAATGGCACTATACAATTACGAATTATTTAAGGTTTCTAGAGACTTATGCACTAAT
GATGTACATAAAAGTATGAATTATATTAATTAAGCAGTTGAGCTTGACTCTAGTGAATGG
ATATATCTTTTTGAGATGGCTCTTTTTATTAAGCAGTAACTCAAACTCAAGTAAGATTCG
TCAGTAATCATGAAGAAGACCTTAGCTTTAAATCCCTCACATTCAAAAGTTTGGTTTGAG
GCAGCATGTCTAGCTGAGGAGATGTTAGAATATGATCAGGCAAGAGATTACTTAAATATT
GCCCTAAAATTAGATCCTACTAATGTTGAGATTCACAACAAAGTATCTCAAATCTAGTAT
TCGTTAAAGAGATATTAAGAAGCAATTCAAAGCTTAGAGTCGGCTATTTAGATCTATCAC
AATAGTGGGAATTAATGTCAGTCTTCCCTATCTGTACTTCTAGGAAATTTAGGAATGATA
TTTTCTCATATTAATGAGCACGAAAGAGCCTATGCATTGCTACAATAATCGATACAGTGC
GATGAAAATAACTTACACAATTGGATTTAGTTAGCAACACTAGAAATGAAAATAGGAAAG
TATGATAGTAGTATGCAAATCTGTGAAAGGATATTGATGTCAGATTGCACAAATGAAAAG
GCTTTTGAGCTCAAAGGGGATCTTTTCAAATGTATTGGTTAATTCGATTAAGCTTTCTAT
TTTTATAGCAAAGCTATTGAAGTTAATCCTGAAAGCCATTCTGCTAACAGTTCTATTGCT
GATCTCTATAGAAATTAAGGAAAACTAAGGGAGGCTATTGATCATTACAAGAAAGCTTTG
TCTGTTAAGTTAGATCTAACAGCAACATTTGCTGCACTATGTAATGCAAAAATGTTCTGC
TGTGATTGGGATTAAAATGACGACTGCTTCAATCATTTGTACAATTTAGTTTCAAAGCAA
ATGGAATCTGGTGAGCTACCTTGTGTAGATCCTTTTTCGCTTTTCATGTATAGCTTCACT
CCTGAGTAAAAGTTCTTAGTAACAAAAAGATATGCAGAGCATATTAAGACTAATACAATG
AAGACTCTATAGGCATAAGGAGTTGAATTTAATGGGTTTACTCATTAAAAGTTAGATCCG
CATAATAAGTTATTCAAAATAAGGCTAGGCTATGTGAGTTGGGATTTTGCAGACCACCCT
TTAGCTTAACTCATGGCATCAATATTTGAAATGCATGACAGATCAAGATTCTAAGTTGTA
GCTTTTAGTTTAAGAAAGAATGATGGCAGTGAATGGCGATAAAGAATTGAAAGAGGATGC
GATGAATTTTATGAGATTCCTGATGGAATGGGCACAGTTGAGTTTTCTAATATGATTTAT
TAAAAGAACATTCACATCCTGTTTAATTTGAATGGGTGGACACAGGGTCATAGATCTGAT
GTATTTGTTCTAAGACCAGCGCCTATTTAAATTTCATATATGGGATTTTGTGGATCTATG
GGAGCTGATTATATTGATTATCTAATTACTGATAAAATTGCTTCTCCTCCTGAGTATTTA
TCACGATTTTACAGTGAAAAAGCTATATATATGCCTAATTCATACTTTGTGAATGACTAC
TATCAAAGTTCTTAATATGTTATTGCTCCAGATTTTAAGAGGTCTTGCCGAGAGTAATAC
GGGCTACCTAATGATAAATTTATCTTTGCAAACTTTAACCAACTATACAAACTTGATCCT
AACACATTTACTGTGTGGATGAAAATATTAGGAAGAGTGCCAAATTCTATATTATGGATA
GTTGAATATCCAGCAGAGGCAAAGGAAAATTTATTGAAAGAAGCTGTTGCAAGAGGGATT
GACCCTTCTCGAATTATAATGACAACCAAGGCTCCTAAGCATGAACATATTGAGAGATGC
CATTTAGCTGATTTATCTTTAGATAACCCAATAACAAATGGCCATACAACAACTTGTGAT
TTATTATGGAGTGGACTTCCCATTATAACTTATCCATTCTCAGAAAATATGCCTAGCAGA
GTTGCTGCCTCAATTTGCCAAGCTCTTGAATGCCCTGAGATGATTGTGACATCCTACTAA
GACTACGAAGAGTATGCAGTTAAGCTAGCTACTCCAACTGACCTTAATAATCTGACGCCA
GAGTAAAAATATTTGCTAGCTGATATCCCACCTCAAATATTATAGAGACCTCATGGATCT
CTAGAATTAAAACATCTCAGAGCAAAGGTAGAACATAAGCGAGTGCGAGCTCCCCTTTTT
AATACCTAGCTTTGGGTCTAGCATATGGAAGTAGGATTAGTCAGAGCCTGGGAAATGTAT
AATAATGAAGGAAAGAAAGTGGACAATATCAAAGTAGCAGACCTACTCAAGAATAATTTG
TATTCCTCACACTAGTAGGAATCTCCACTAAAGCTTTAAACACCCTAGAAACCTTAATTT
CAACAGCAATAAGGACTATTAACAGAGAGTTTAAGTACTCAATAAAATACCCTTGCAAAA
GTTTATTAAATAAATTAAAATGTAGCTTCATCTTGA


>Contig17290.0.g12(protein)
MWTFGKNNDSQTKHTSISHQNLQFNNEQMMNSPRTDRLEKCLIRIDESKSEGRNSDVIST
CHQALQILQDEPFADQELNQSFYSKFHARLAQAHLSLGDMNNAFSVADQLIGSIAQSPQL
IQANKYQFIDALIVKCHILIQHNQLNDAAQLISEIEILQPKTQNVNTQASLAHSFSGNSI
PQPQLGHGDYFKNSQSIRGNSIDGSDVSGFESIEEQTVNLELSLVKYEFLIHSGNQELAV
NILQDAISQASQSTQGILNNFLIDGRYTNQNRSFNSCSIDGNSTFNHQTVLQLTLFFQLI
ERCYQKLMEIQIKQLTTSQQLAIIPNSAQIPSSQQILSANQDTQDSQSKELLSQNQKEIN
KIMALYNYELFKVSRDLCTNDVHKSMNYINQAVELDSSEWIYLFEMALFIKQQLKLKQDS
SVIMKKTLALNPSHSKVWFEAACLAEEMLEYDQARDYLNIALKLDPTNVEIHNKVSQIQY
SLKRYQEAIQSLESAIQIYHNSGNQCQSSLSVLLGNLGMIFSHINEHERAYALLQQSIQC
DENNLHNWIQLATLEMKIGKYDSSMQICERILMSDCTNEKAFELKGDLFKCIGQFDQAFY
FYSKAIEVNPESHSANSSIADLYRNQGKLREAIDHYKKALSVKLDLTATFAALCNAKMFC
CDWDQNDDCFNHLYNLVSKQMESGELPCVDPFSLFMYSFTPEQKFLVTKRYAEHIKTNTM
KTLQAQGVEFNGFTHQKLDPHNKLFKIRLGYVSWDFADHPLAQLMASIFEMHDRSRFQVV
AFSLRKNDGSEWRQRIERGCDEFYEIPDGMGTVEFSNMIYQKNIHILFNLNGWTQGHRSD
VFVLRPAPIQISYMGFCGSMGADYIDYLITDKIASPPEYLSRFYSEKAIYMPNSYFVNDY
YQSSQYVIAPDFKRSCREQYGLPNDKFIFANFNQLYKLDPNTFTVWMKILGRVPNSILWI
VEYPAEAKENLLKEAVARGIDPSRIIMTTKAPKHEHIERCHLADLSLDNPITNGHTTTCD
LLWSGLPIITYPFSENMPSRVAASICQALECPEMIVTSYQDYEEYAVKLATPTDLNNLTP
EQKYLLADIPPQILQRPHGSLELKHLRAKVEHKRVRAPLFNTQLWVQHMEVGLVRAWEMY
NNEGKKVDNIKVADLLKNNLYSSHQQESPLKLQTPQKPQFQQQQGLLTESLSTQQNTLAK
VYQINQNVASS