Identifiers and Description

Gene Model Identifier

Contig6519.0.g55

Standard Name

KELCH95

Aliases

Contig6519_0_g55

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6519.0.g55(coding)
ATGCTGTAAAACCAAAAATAAGGAATTTTAGAAGATCCATTTCGCTATGACAAAATCTCT
CCTGAATAAGATGTTTAACTTTTAATGAAAGCTAATAATCCAAAAAGGCGGACGAGAAAA
ACTGAAGATAAAATTCGCCAAACTTTAATTAAAGAATTGGTCAAAGAACAAATATTAGAG
TAAAAGCGTTTAGATGAATTAGCAAAAGTGAGATTGTTAGATCATGAAAGAATATGTAGA
TCCCTATTTTATAGATTTGATAGTCAAATTTATACATAGGCTTTTGATATGGAAAACGTC
AAAGAATTTGAAGATCCAGTAATAGCAAAGGAATTGAAAGTTAAGCGGTATAAGTAAACA
GCTCTTGTTGAGCTGAAACTCAATTAAGATGGACATGATATCTGGAAGATTGTAGCTATA
GGCATAGAACCAAAAATTGTGATCTTGCAAACTGACAAAACTTCAAGCAAGACTGAGTTA
ATTCCAACTAACCTCACTCTTCCTCTGATAAGAAACTTCTCTTGGTGCTTATCCCCAGAA
AACATTCTCTATGTAACAGGAGGTGAAACTCGCTACGAAAAATCTTACACTCAAAGTAAA
TTGAACTACGGTTTTGCTTTTACTTTAAGTGAAGATTCATAAAGCGTAAATGGTCATTAG
ATTTAAGTCCCTTAACTTATTAAAGGGAGATTTAATCACAGTAGTTTCTATCTAGACCAC
AAACTATTCGTTATTTTTGGCAGAAACATGAAATATTTCACTCAAGCACCCTACTTAAAT
GACGAATATCACACTACTTATGAATATTGGGATACTAGAAATGGAACTAAAATTGGATTT
ATAAGTCAGTAATTAAATTGTTAACTGAGAGTTTAATAAGTTATGATGTTTCATACACCT
ATAGAGCAATCGAAGTATTACTTTTTTGGAGGAAAATCTGATCATCCAGAATATAATACT
AAAGAAAAATGCCCTCTATATAATTTTTAGGTTCAAATATAGTAGAATTAGCAAGGAATT
GAAGAGATTAATGTTGATATTTCGCAAGAGATGGATGAATAATTAAATTTCTAGGGCCAA
CCAATATTTCACAGTACCCTGTAAAATAAACTTAGTTTCAAAAATGGACTATAATGGGTT
TTTATTGATCAAAATAACCTAAAACACTATTTAGATTTGCAAAATAGGCAAGTCAATTAT
CCTATAGTTATTAAGACTTTATGA


>Contig6519.0.g55(protein)
MLQNQKQGILEDPFRYDKISPEQDVQLLMKANNPKRRTRKTEDKIRQTLIKELVKEQILE
QKRLDELAKVRLLDHERICRSLFYRFDSQIYTQAFDMENVKEFEDPVIAKELKVKRYKQT
ALVELKLNQDGHDIWKIVAIGIEPKIVILQTDKTSSKTELIPTNLTLPLIRNFSWCLSPE
NILYVTGGETRYEKSYTQSKLNYGFAFTLSEDSQSVNGHQIQVPQLIKGRFNHSSFYLDH
KLFVIFGRNMKYFTQAPYLNDEYHTTYEYWDTRNGTKIGFISQQLNCQLRVQQVMMFHTP
IEQSKYYFFGGKSDHPEYNTKEKCPLYNFQVQIQQNQQGIEEINVDISQEMDEQLNFQGQ
PIFHSTLQNKLSFKNGLQWVFIDQNNLKHYLDLQNRQVNYPIVIKTL