Identifiers and Description

Gene Model Identifier

Contig6353.0.g77

Standard Name

KELCH94

Aliases

Contig6353_0_g77

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6353.0.g77(coding)
ATGAGTGACGACCAGTAACAACAGTATCTTTAAGAATTGGCTCTATCTTAAATTGAGCAA
GTCAATAGGAATTCAAGCAGCAGCTCTCATAATGATAAATAACAAAGCCAATTTTACTTA
GAGAGATAAGTCAACCCAGAAGAAGAATTTGATTATTTGAACAGTTTAGGAATGACTCAT
CAAGTTAAGCAAGAATTCAGTCAGAAAATGCCAAATAATTAACAAAGAAAAAATTAAGTA
TTCTAAACTCAACATCATAGCTCTAATGTATAAAATGTTAGGAATTAAGTGTTGGATTTA
TCATTAAAATTAAGGAAAGACCCTTAAGAAATACCGAGATAAGATCAAGAGATACTTTAA
CAGTTTCTAAAGAAACTTTAAAAACCTTCAGATATCCAGGCTCTTACACAATAAATCCAA
AAAGTTTATATTCATAAATTAACTCAGAAAAACAAGTAACTAACTGAGTAACTTTATCAA
TATTTCAAAAATTCAATCGAAACACTTTATGGCTAATTAGAAGTTTAAGAATGGAATAAT
AGATAGTCAATCTAATATGAAAACTAAGTCCTGTAAAATTCACTATTATAGACTTTTGAT
AGTGTTTAGCAAGGTGACTAAGATCAAGCTAAAAATAACTTATCTGAATTGAACTAATAC
CTAATGTAAAGATAGAAGACAATTGATGGGCTACTAGATGATATTTATTTGAAAATGAAA
AATGCTGTAACATACTCTATTGAGAGTATTTCAAACTAAGTGATAAGAGAAAGCACTTTT
TAGTAATACTTTATGAGAGAAGAGCAGAGAGATTAGGAAATTAAAGTGTAGGCACTAGAG
AAACTCAACTTATATAAGGCAACGATTGATAAAGTATCAAGTCACGAAGAATGTGGATAA
TCTGCAAGTCAGCATTTTATGTATAATGTTAAAAGAACTAATTCAAAAGCTCACATGAAG
AAAGCCTAAAATGTTGTTAAATTGGAGAGTTTAGATGTTGAAAGAGTAAAAGAAGAACTT
ATAAAAGTGGAGAATGGACAAGCCAAGAAGTCAGAAATTAATGTTTCAAAAGAGGACATA
AAAATAATTAAGAGAGAAGAAGACTTAAAGAGAACCTTTAACCTGTCTTCAAATGAAATG
GAATACTTTAGCAATTTTGAGCAAGCTGAGTAGTTTATAGAGTAAAAAGTGCTTAACAAA
ACTAATTTTATTGTGCTAGCAAGTTCATTGAAAAAAGTACAGTAGATATTTATTTTAAAG
AAAGATTTGGGTGTGCCAAAAGTTCATGAGGTTCATATGATTAATTAAGAGTCAGTTGTC
TAATTTCATGTTACAAATATATCACCCCATTATTTAGTAATCACTATGGCTTTATTTGTT
ACAACAGTAAGAGCAAGGATAATATTTGTGGATTGCTAAACAGGGGAGATTATTTTAAAG
AAAGAAATAATAAGCCCAAATCCATCATAATTTAAATGTTATTACCAAGACCCTTACTTT
TGCATACTTTACGGCAGAGCAAAGTTGATACTTATTGATTTTACTAGAATAATTCAAGGT
TATTAGGAAGATTTTCATGAACTCTAGACGACACTAAACTTTAAATCTAACTATAAAATT
TAAATCCAACCTCTAATGGGCTAAGGACCTACTGATCTACTGGGCTTTCACTATAGCTCA
TAAGAAAGAGTAAATTAAATCTTTTAATTTGGCTTAAGTTCAATCACCGATCCTTAAGAG
CTAAAAATTTGGCTTGCATAGCAAGACAAAATAATCGAATATGAAATTCAATCAGCTGGC
AAATTGATGGTAGTTGATTTAAGGAAGACTGAAATTGAAAGAAACGAAATTCCAAATAAA
ACTTACAACTACGGTACTATTGCTCTGAGTCCTGAGAGAATTTTAATTATAGGTGGCATT
AGTGAGCAACAGGGTACACCAAGGGATTAATGCTATGTTTATGATTTAAAAACTCGACAC
ATTGACAAATGTGCAGAATTGTACTTGAAAATGAAGGATGCTTTTACAAACGAAAATTAC
TCTTATTATGAGGATGAGTTTTAATATGTGGTGGCAGGGAGATGCTACCTTCATTTACTA
GATAAAGCTAAGATGCAGTGGGAACTAGTCGAGGCTTATATTTAGACACCGAAGTTTCAG
GTTGATTAAGCGATATATAATTAAGATTTGCTTTGA


>Contig6353.0.g77(protein)
MSDDQQQQYLQELALSQIEQVNRNSSSSSHNDKQQSQFYLERQVNPEEEFDYLNSLGMTH
QVKQEFSQKMPNNQQRKNQVFQTQHHSSNVQNVRNQVLDLSLKLRKDPQEIPRQDQEILQ
QFLKKLQKPSDIQALTQQIQKVYIHKLTQKNKQLTEQLYQYFKNSIETLYGQLEVQEWNN
RQSIQYENQVLQNSLLQTFDSVQQGDQDQAKNNLSELNQYLMQRQKTIDGLLDDIYLKMK
NAVTYSIESISNQVIRESTFQQYFMREEQRDQEIKVQALEKLNLYKATIDKVSSHEECGQ
SASQHFMYNVKRTNSKAHMKKAQNVVKLESLDVERVKEELIKVENGQAKKSEINVSKEDI
KIIKREEDLKRTFNLSSNEMEYFSNFEQAEQFIEQKVLNKTNFIVLASSLKKVQQIFILK
KDLGVPKVHEVHMINQESVVQFHVTNISPHYLVITMALFVTTVRARIIFVDCQTGEIILK
KEIISPNPSQFKCYYQDPYFCILYGRAKLILIDFTRIIQGYQEDFHELQTTLNFKSNYKI
QIQPLMGQGPTDLLGFHYSSQERVNQIFQFGLSSITDPQELKIWLAQQDKIIEYEIQSAG
KLMVVDLRKTEIERNEIPNKTYNYGTIALSPERILIIGGISEQQGTPRDQCYVYDLKTRH
IDKCAELYLKMKDAFTNENYSYYEDEFQYVVAGRCYLHLLDKAKMQWELVEAYIQTPKFQ
VDQAIYNQDLL