Identifiers and Description

Gene Model Identifier

Contig20027.0.1.g86

Standard Name

KELCH91

Aliases

Contig20027_0_1_g86

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011641902.000769134519826e-18Kelch motif family protein
SGDYPL263C0.00000039992052383199455KEL3 SGDID:S000006184, Chr XVI
from 46506-44551, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20027.0.1.g86(coding)
ATGTAGCATATTGAGCCAAGAGGGAAGCCTGTGATACCTCTAGAAATTAACATAAAGAGC
AACGAAGGATTGCTTGAGGAAGATTAATTGAGATTGACTTAACTAGTAACTAAATTTGAA
CAGAGAAGGCTAAAATCACTCATTAGAGAGCCTAACAAATAAGAAGAAACTGGCTTCTAC
ACCAAAATACAAGGATATCAGACGAAGCCTAAGATTTATAATAAGAGAAACTTTGAGTTC
TTGGCTGCTACTCTTAAACATAATAAATCTCTAAAGACCTTCGCTTACTCAATTGAATTA
GATGAATAAATAAGCAATAATACAAATCCAATTGACCAGTAAATTTTATCAACTTAAACG
GAAAGCTTCAGGCCAGTTACAAATGTTAGAGAGAAAGAAAAGTTATAGAATATGATCAAT
AAAAATTTGTACAGCACTCATTAAAAAGAACTGAAAAATATTTTGATGAACAAATTGAAT
TCAAGCTCTGTTAGAGATTTGCAAATGACAAAGTTAGTAAACCAAGATACTGAACTTGAG
TTAGAGTAGCTTACTTTGGCAAACTAGAATATTACAAAATAAATGGATTCTATTGGGGAT
ATAATAGAAGAACAGCAAGACGATGAAACAAAGAGTAAAATAAGTTTAATAGATGAAAAA
AAAATTTCTCCTATTGCCAAAATTGTAAATCCTTCTCATAGCGTGTTTTCTTTCAACATT
GACACTGTCAACGATAAGATATATTTCCAGAGAGTTGAAAAAGAACTCACATAATCAAGG
AAAGATATTAATCAAAATGAAGGAGCTACCTATAATTTGACATCATAGGGATTTATTCAA
GATTATGATGTGCCAGATAATTAAAATCATTAGTACAAACCTGGATATTAAAGTATTCTT
GGTTTTCCAGATAATATTGAAGAGTTCAATTAAAGATTCCTAAAAAGACAGTTAACTAAG
AAAGATGAAATATAGACTAAGAATTTAGAGATTCAGGAATTTTAGAAAACAAAGTTTTCT
GGGGCATTAGATTACAGAATGAATACTTTAGATGCACAGTTTTTGGAAGATTAGTTAGAA
CTCAGAAGAAAAGAGGAAGAGAAAAAATTTATAGGAGGAAGAAAACTTAAAATCAAGATA
CCAATTAAAGAAGAGCCAAAGGACTAGTAATTTGATTTGATTGATGAGTATGCTAAAGCA
AAAGAAGAAAAATAATTAGGGAAAACTATGCAAGGTTTATGGGTTAAATATGAAGGAGAA
GGGCATTATCCTCCAACAAGGGAAGGAGCAGGTTGTGTAGTTATTGAAGACAAAGTTTAT
TTGATGTTTGGCTTCTAAAATGTGATTCTTGATGATATTAGATGTTTCGATGTTAAAACA
TTTAGATGGGAAAATCTAACAAATAACTTAAGAGGAGACAAGCCTGATAAAAGATTCAAT
TTTAGCTGTGGCAAATATAAAAATAAAATAGTCATATTTGGAGGAGCATCAAATTACCTA
AGTCGTATAAAGCAAAGAGAAACTTTTAATGATATTTGGATTTTGACACCTAATACTGAA
GATTAATTGCCATCATAAAATCCTTGGATATAATTACCTTCTATTGAGCATGTACCTGAA
AGATCAATGATGCACAGTGGAGATACCTTCGGAAGTACATTTGTAATATATGGAGGAATG
AATAAGCAAAAGTAAGTGCTAAACTAGCTTTTAATATATGATATTGAGGCAATGACCTGG
GTTAAAGCAGTCAAGAAAAAGAAAAGCTCGGATATTTCTATTTGTCCTAAATTTATGCAC
ACTTTGACAGCAGTTATAATTGATAAACCTAGCTAATCCCCAAAGGTAATCTAAGACTAG
CCAATGACTCCCACTTCAGATTTGGAATTCAATGAAGACATAAAGTAATCTACGGATAAT
AAAGCTTTCCTAAAGACACAGCAATAACTCTTAAGCACCACAAAATCAACATTCACTCAA
AACAATAGTTTTTACAATCCCTATCAGAGTCAGCCCAAGCATGATAAAAATGGAATCTCT
GGATTGTATTTATTTGGAGGTATGGATGACCAGGGAAACGTCTCAAATGATGTGTGGCAT
ATCAAACCATCTTACTCAAAGAACTTAGACAATTTAGCACCTGGCACTCACGAATACAGA
GAGAACTTTGAGAAGAAACTGTTCTATGATATTTCACTTGTTAAAACCATGGGGAAACCA
CCCATTGCAAGATACTGCCATTAAGCTGTTTGCTTTTAGAGTAAATACCTCTTGATTCAT
GGAGGTAGAAACAACAAAGAAGCTTATGACTTGACAAGAAATATGGAGTCATAGCTTAGT
TAATGTAAATGA


>Contig20027.0.1.g86(protein)
MQHIEPRGKPVIPLEINIKSNEGLLEEDQLRLTQLVTKFEQRRLKSLIREPNKQEETGFY
TKIQGYQTKPKIYNKRNFEFLAATLKHNKSLKTFAYSIELDEQISNNTNPIDQQILSTQT
ESFRPVTNVREKEKLQNMINKNLYSTHQKELKNILMNKLNSSSVRDLQMTKLVNQDTELE
LEQLTLANQNITKQMDSIGDIIEEQQDDETKSKISLIDEKKISPIAKIVNPSHSVFSFNI
DTVNDKIYFQRVEKELTQSRKDINQNEGATYNLTSQGFIQDYDVPDNQNHQYKPGYQSIL
GFPDNIEEFNQRFLKRQLTKKDEIQTKNLEIQEFQKTKFSGALDYRMNTLDAQFLEDQLE
LRRKEEEKKFIGGRKLKIKIPIKEEPKDQQFDLIDEYAKAKEEKQLGKTMQGLWVKYEGE
GHYPPTREGAGCVVIEDKVYLMFGFQNVILDDIRCFDVKTFRWENLTNNLRGDKPDKRFN
FSCGKYKNKIVIFGGASNYLSRIKQRETFNDIWILTPNTEDQLPSQNPWIQLPSIEHVPE
RSMMHSGDTFGSTFVIYGGMNKQKQVLNQLLIYDIEAMTWVKAVKKKKSSDISICPKFMH
TLTAVIIDKPSQSPKVIQDQPMTPTSDLEFNEDIKQSTDNKAFLKTQQQLLSTTKSTFTQ
NNSFYNPYQSQPKHDKNGISGLYLFGGMDDQGNVSNDVWHIKPSYSKNLDNLAPGTHEYR
ENFEKKLFYDISLVKTMGKPPIARYCHQAVCFQSKYLLIHGGRNNKEAYDLTRNMESQLS
QCK