Identifiers and Description

Gene Model Identifier

Contig9050.0.4.g23

Standard Name

KELCH90

Aliases

Contig9050_0_4_g23

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003103901.000137892321693e-31Kelch motif family protein
SGDYHR158C0.0000020007268868677913KEL1 SGDID:S000001201, Chr VII
I from 417179-413685, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9050.0.4.g23(coding)
ATGGAGAATAAGAAGCAGCAATTCCAAAACATATTGGTTCAAAACATTTCACAAAAAAGA
AAGATTGCCTTAATGCCTAAAATAAGAATTAAAAACGTCAGTGCTGAGCTAGATATGGCC
AAGCAACTATTCTCAACAAAGTCGGATTAGAATGAATCCAACAAGGACTAATTAAGATCT
AGCATAGGTAAACGAGTATAATTTAAAGATGATAACTACGATATGAGCAAGAATTTCTCA
GGTGAACATACTCTAAAAGATTCTTCTCTTTACAAATAAAATGAAGACTCTAGGGCGTTT
TTATGTCATTTCAAAGATGATGTAAATGAAAAAGAACTCATAAAACTGGAAACCAAAAAA
CGATTATTAGAATTTTAAACTATTGCTGAAATGAACCAATCGTTGTTTGAACCTAAGTTT
ATTAATAATCTTAAGTAAAAATAGCGGAGTCATTCAAAGCCATAGACACCAATAAGTGAT
ACTTTTAGTATAAAAACAAGGTCAGGGACTCCTTAAAGTAAAATATAGTATAGCAAATTA
CAAATACAATTGAAAAGAATGTAAATGATGAATGAATATAAGAAAAATTAAGATTAAAAC
CTATATGACACATCTTTTAACTCGTCAAATATCTAAAGACCTTAAACTTCTCTATCTACC
CAATATAACTAACTTTTCTTAAGAAAACGAAACTCAACACCAAGTCAATCTAACAATAGA
CTCGATGTATAATAAATAGTTTATTCTAATATGATGTCGAGAGTTCCCCACACAAAAGAA
GCTTTCATTAAATTCTATCTGTTAAAAAAGGATAATCATAAGTGTCCTAGGCAAGCATTT
TCGTATTTTTAAAAAGATCCCGTAAGCTCTTAAGAAATTATGGAAACAAGAGAGGGTTCA
ACAATTCTAAAGTCAAGCTATGACAATAAAGTCTATATTTTTGGAGGAAGAAATATAGCT
CCTCTTCCCAGGTTAGAACAGTATGATTTAGAGACAAATGCATTTAAGCTAATTTATCAC
GACTATGAGCATAAGATTCAAGGTAGGTTCAACCATAGTATGATCTAATATGAAAACTCA
TTAATATTCTATGGAGGCTAAACTGGTAGTGCTTCTATAAAATCCAAATCATAAGCCCTT
AAAGATATGATCTGTTATAACATAGACACAAAAGAATGGACAGAGAGGATACAAAATAAA
TTACAGCCATATTCTAGAAGAAACCATTCTGCTTTTTAACTTAACAGGTTTATGGTCATA
TTTGGTGGTATAAATGAATTCAATTATTAATCAAGTGATACGCTGATTTATGATCTTGAT
GAAAACTTTTGGATCACTGACATTCCTATCATCGATAATTAAATTCAACCCCTATCACAT
TCTAGAGGTCATTCAGCTTTCTACAATTAAAGGAATTCTGATTCCATGCGAACAATTTTG
AACTTAAAAGATATTGATTGGGGTAATAGCTCACAGCTTATATAGGAAGAGGGTTTTTAT
ATCTTTGGAGGTCTATTATCTGATGGCTCAGCTTCCAATGATTTATGGATTTTAAAGCCA
TTTAAAGACTAGCTTTAATGGATTAATGGAGATAAACTCTGCTCAGGTAGAAAACCAAAG
CCAAGGTATTCTCATTCTTTGACTTATTTTGAAAAAGAAAATTCTCTTATTATAACAGGG
GGAAGAAATGATAGAGGGAAGTTCATGCACAGTGATATTTATCTATTGACTCTTGATAGG
TTAAACTGGATCCAAATCGAAATAGTTGGTAATGGTATGATGGCAAGAGCTGATCATTTC
TGTGTTCCAGGTTAAAACCCAGATGAATTTGTAATTCTAGGGGGAATAGATTCAAATTAC
CAATTAACTAGCAAGATTTCATTTATTTCTTTTGATACAGAAAGTTTAATTGAGAAACAG
AGACAAAGTCCAAATGGTTCAAAAAGTCAATATCGTTAACCTATTCAAAGATTATCTTTT
GGTTAAGTTTAAAGTTTCAATAATTGA


>Contig9050.0.4.g23(protein)
MENKKQQFQNILVQNISQKRKIALMPKIRIKNVSAELDMAKQLFSTKSDQNESNKDQLRS
SIGKRVQFKDDNYDMSKNFSGEHTLKDSSLYKQNEDSRAFLCHFKDDVNEKELIKLETKK
RLLEFQTIAEMNQSLFEPKFINNLKQKQRSHSKPQTPISDTFSIKTRSGTPQSKIQYSKL
QIQLKRMQMMNEYKKNQDQNLYDTSFNSSNIQRPQTSLSTQYNQLFLRKRNSTPSQSNNR
LDVQQIVYSNMMSRVPHTKEAFIKFYLLKKDNHKCPRQAFSYFQKDPVSSQEIMETREGS
TILKSSYDNKVYIFGGRNIAPLPRLEQYDLETNAFKLIYHDYEHKIQGRFNHSMIQYENS
LIFYGGQTGSASIKSKSQALKDMICYNIDTKEWTERIQNKLQPYSRRNHSAFQLNRFMVI
FGGINEFNYQSSDTLIYDLDENFWITDIPIIDNQIQPLSHSRGHSAFYNQRNSDSMRTIL
NLKDIDWGNSSQLIQEEGFYIFGGLLSDGSASNDLWILKPFKDQLQWINGDKLCSGRKPK
PRYSHSLTYFEKENSLIITGGRNDRGKFMHSDIYLLTLDRLNWIQIEIVGNGMMARADHF
CVPGQNPDEFVILGGIDSNYQLTSKISFISFDTESLIEKQRQSPNGSKSQYRQPIQRLSF
GQVQSFNN