Identifiers and Description

Gene Model Identifier

Contig22838.0.g50

Standard Name

KELCH9

Aliases

Contig22838_0_g50

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007603905.001841681745041e-174Kelch motif family protein
SGDYGR238C1.9999391735788327e-19KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22838.0.g50(coding)
ATGCCTGGACAAGGGTTTGATGGATAAATACAAGATAATGGGATGTAATAATTCGAAGAG
GAAGAAGAAAAGATTCAATCAAAGAAGAACGAAAGAAAATGGTTTTGGGCTTTTCCATAA
ATTGAAGGAGTTCCACCCTCACCCAGAGGAGGTCATTCTGCAACACTTATTGGAGCTTCA
ATCTTGTACTTTGGTGGTCATTATTACGGTGGTAAAAAATCTGGCTACACGTACCTTAAC
GATACACACGTTCTTGACTTAAATTCTAGTCGTTGGATCAAACCAAAAATCTAAGGTACA
CCCCCTCATCCAAGATATGGTCATACAGCTATCTTAGCTGGAAGCAGAATTATTATCTTT
GGTGGAAAAGGAGGCAAGAATCAAGCTCACAGAGATTTACATGCACTAGATCCAGTCACA
ATGACTTGGTATTAAGGACCTGAGGGTGCAGGAGCTCCATTAGCAAGATTCGGGCATACT
GCCAATTTAGTAGGAGGTACAAAGATGTACATTTTTGGAGGATGGAATGGAAAAGATTAT
TATAATGATTTGCATATTTTAGATCTAGAAATCATGGCATGGTCCAGACCAAACGTTAGC
GGTCCAGCTCCTTCTCCTAGATAAGGCCATTCCTCAATTTTGATTGGAAATAATTTGGTT
GTACACGGTGGTTTCAAACTTAGAGAAGACCAGCTTAAAAATTGTGGACTGAACTAAGGC
TCAGCTGTAAATGCAAGCTACCTGAATGACATCAGAGTACTGGACACGGATACTTTTACC
TGGTCTAGATTAAGAATATCTGATGAGCCACCCGAAGCCAGATATGGCCACACCCTTAAT
ATTTCTGGAAGTGATATTATCATGTTTGGAGGATGGACAGTTAACTCAGGCAATAGAGCA
AAGCATGAAATCAAGAAAGAACAGTGTGATTATTTTATGATTTGGAATACCGAGACTATG
TCTTGGAAGAAAGGCAAATACATTGGAAACCCGCCTACTCAGAGATACGGTCACACAAGC
ACAGCAATCGGTCCGCATCTTCTTATCTTCGGAGGCTGGGAATTCTCTAAAGCTCAAAAT
GAAATCATTGTCTTGAGGGAGTTCAATCAAGATGCAGCAGCAGGCGGAGGTCTAGTCAAC
AATAACAATAGCAAGTCATTAGTAGGCACGCAATCGAAGGGATCCAATGAATAAAGCCAA
AAGTCACTTAAGAATATGAGTGATCGCATGAAGGAATATAGAGATTGA


>Contig22838.0.g50(protein)
MPGQGFDGQIQDNGMQQFEEEEEKIQSKKNERKWFWAFPQIEGVPPSPRGGHSATLIGAS
ILYFGGHYYGGKKSGYTYLNDTHVLDLNSSRWIKPKIQGTPPHPRYGHTAILAGSRIIIF
GGKGGKNQAHRDLHALDPVTMTWYQGPEGAGAPLARFGHTANLVGGTKMYIFGGWNGKDY
YNDLHILDLEIMAWSRPNVSGPAPSPRQGHSSILIGNNLVVHGGFKLREDQLKNCGLNQG
SAVNASYLNDIRVLDTDTFTWSRLRISDEPPEARYGHTLNISGSDIIMFGGWTVNSGNRA
KHEIKKEQCDYFMIWNTETMSWKKGKYIGNPPTQRYGHTSTAIGPHLLIFGGWEFSKAQN
EIIVLREFNQDAAAGGGLVNNNNSKSLVGTQSKGSNEQSQKSLKNMSDRMKEYRD