Identifiers and Description

Gene Model Identifier

Contig21550.0.g89

Standard Name

KELCH88

Aliases

Contig21550_0_g89

Description

Regulator of chromosome condensation (RCC1) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010131901.000403801267624e-40regulator of chromosome conden
sation (RCC1)
SGDYGL097W5.002171138422328e-22SRM1 SGDID:S000003065, Chr VII
from 321782-323230, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21550.0.g89(coding)
ATGCCAAAAGATAGAGAGGGATACCCATTTTAACCACATCCACTAGAGATTGACATGCTA
AGAAACAAAGGAATTTACTAGGTAGCAGGGGGAGACGGGCACACTGTCGCAGTAGATATC
AAGGGCAACGTATATTCTTGGGGTGCTAGTGCTTGTGGGCAACTTGGATTGGCCTCGATG
AAAGATCTACCTACTGATGTTGAGGGATATCCCTATCAGCCTACGCCTAGAATTATTGAA
CTACTCTAATCAGTTAAAGTTATCTAAATTGCTTGTGGTGATGCACACACAGTTGCATTA
ACTTAAGATGGAAAATTATATTCTTGGGGAGGCGGAGGTTGCGGCTAACTTGGTCATCCA
GATACCTCAGCTATGCCTAAGGATGAAGATGGCTGCCCTTATCAACCAAAGCCTAAACTC
ATAGTGGTGTTGAAAAATTTAGAAGTCAAATAAGTAGCATGTGGAAAGGCTCATACTGTC
GCAGTCCTCAACAATGGTCATTTGTACTCATGGGGTGCAGGGGCATGTGGGCAACTTGGA
CACCCTGATACTTCCAGTTTCCCAGCTGATGAAGATGGCTATCCATACTAACCTATTCCT
AGGTGTGTAACAGCATTAAAACCATTTAAGCTCATTCATGCTTCTTGCGGAGATGTACAT
ACTATGGTCCTAACAGATCAAGGTGAAATTTACTGTTTCGGAGGTGGATCCTGTGGTTAA
CTAGGATTTGGTAATATCTCATAGATGCCCTTAGATGTCGATTCTTGCCCTTTCATGCCA
GTTCCTAAAAAGATTGAAAGTCTACAAGGAATCTTCATAGTGTCTCTATCATGCGGTGAC
TCACACTCAATGGCTCTTTCTAGAGAAGGGCATGTTTATGCTTGGGGAGAGGCTACATAT
GGCCAACTTGGATTAGATGATATCAGAGATTTACCAAAAAATACAGATAACAAGCCATAT
CAACCATTCCCTTAGAAAGTAGTAGCTTTGATGAATAAAAAGATTGTTGCCATTTCATGT
GGAGAAACTCATACACTTGCACTAACTGAAGGGGGTCATCTATATTCCTTTGGTGGTAAT
ACATGCGGACAGCTTGGTTAATATGTTAAAGAATTAGAGAAAGGCAGAGGCAAGAAGGGT
GGCTATGAGGAAATAATTTTCCCTAAAAATTCTATAGAGAGTAATCCTTATAGTTTTATG
AGCAACAGCGACTCACCACCCGATACTCCAAACGAAAGAAGAGATTATAGCTTCAACTCA
TAGCACAATATGAGTCATGGAGGAAATACATAAATGGATGATGTTTCAAATCCTTTGAAC
TCTCCGCCTTCCCTTTTCTCACCATAGGATTATGGAATTGATTCTTTATGTATGCAACCT
AAGCTCATTAAATCTCTCCTCCCAAGAAAAATAATAAAAATCTCAAGTGGAGGTGTCCAC
AACATCTGCATTGTAGAGCCTCACCCCTCAAGTATCATGCAAGACGTCTACTAAAGTTTC
ATGCAGAGCAAGTACTGTGATGTGGTATTTAAGGGATTTTACACTACAGTCGAAATAGCA
ACAAACAATACCAGTACAAATGCAGGATAAAATTAAATAAGTGGTCAATCAACCAATAAC
CAAAATATGATTGGGGGTGGGTCTAACACTCAATCTATCATAAGCTAAACTTCAAACATT
GGCTATCATCAATAGAACAATGTTGGTTAAAATTTAATGACTGCTAATTCTAATATTAAT
GAGCATAATACCATCAACTATATTCAGGCAACAGGTTAAGGACTTGAGAACAGCTCAGAC
GAAGAAATGAAGGAAGACTTTGACATGCTGGATGCCTAGAACGATAGCTCATAAGCTCTG
AACTCACACTAAAATGTTTTGAACGATCAGTATTGGAGAGAAAAAGAGAAAACTATTGTT
AACACTAAAATTAATGCTCATAAGTGCATTATTACTCACAAATCAATCTATTTCGCATCA
TTGTTTTTGGAAAGAAATTCATAGTTTAAGATCACTTAATAAGACGATAAGCTTGTGATA
GATTTCAATGGAAGCGTGCAGTATGAAGCTTTTAGGAAGATTGTTGATTACATATATTTA
GATGACTTGAATGTGCTTGATGCAGTTGCTGACTCAACTGAAATGATAGAGATCATTAAA
CTAGCTAAATAATATAATTTGGAATCTCTCTTTAAAGCTTGTGAAGTCCACTTCAAAGAA
CTCATGGTCCAATCTTTCGATTGCTCCAACCTAATTGCATTGAAATATTCAGGAAGTGGT
TTAGCATAGTCTTCTTAGAACCCAAAAGCACTAAGAAAATCAACTAATAAACCTTTGCAT
GATTTGGAATAGAGAGATGGAAACAATGTGATTCGAAGCAGTGGCAGAGCTGTGCAATAG
GTTTCTCAGAGTAGTGGTTAGAGCAGCAAAAAGAATAAAAAAATGTAATAAAAACTGAAT
AATATGCTCTAGGGGCTTATGTTCTTGCCAGATGGAAGAGTCTTAATTATGGACAGTGAA
TTATACAAGTAGACGATTGACAAGTCAATAGTATTAGACTTATTTGAAGGAACATCCTTG
AATCCAAACTCTCCAACTCAAAATTAAATAGCTCCACTAATGAATCAACAACATTAACAG
CAGCTATAACTGCCTTCCTAACCTTACAATTAGTCGCAACCCCCTCATATAAACACTAAT
CACTAATTAAATCAATCCTCACTTGAAGAAGAGAAACAAGGAGGGCAACCAAGAATAAAC
AGAGAAAATACGAACAATTCATAGTAACAATAACAATAGCAGTAGAATAAATCCAAGCAA
AATCAAGCAAATTAAAGAAAGAAGGGCAACACCAACTCTAATGATCAATATGGAAATGAC
AATTAATCTATTACTGGAGGCAACGGCAACAATGGTGGAAACACTAGCATGGGGATGCAG
CAGAATGTACTTGATGGTAGTAGCAGTGGGAGCGGTGGCTTGGAGGAGTTCAATGATGGA
AAGAGAGATTTTCTTGGGATGTTGAACAACAGTGAATTCAGTGATATTACTCTGATTGTT
GATGGTAACCCAATCTACTGCCATTAGGTTGTTTTGGCTTCAAGATCTGGCTATTTTGAA
GCCCTCTTTTCCCACGATTTCAAGGAAAAAGAGCAGAAAGTAGTAAATTTCACTGATGTT
TCCTATGATATTTTCTTGACTCTCTTAAAGCATCTGTATTCTGATTCTCTTCGCATTGAG
CTTAAACAAGTATACGATTTGCTTTCACTTGCTGACAGATTTAGTGTTGCCAGTTTTAAG
AAGAAATGTGAATTCATCCTTGCATAGTATATAAATGTTGAAAATGTCTGCTAGATATTC
AAATATGCCAATACCTTTAACTGCGAGCGATTGAAGGAATCCTGTCTACTCTTTACCGAG
GAGAATCATAACGAAGTAATTGCAAGTTCTGGATTTGAAGACTTAGACAAAGACGAAATA
CTCAAGATTATAAGAGTGGGCAAAGAAAGCAAGAGAAGATTCAAGGGCAGACATTGA


>Contig21550.0.g89(protein)
MPKDREGYPFQPHPLEIDMLRNKGIYQVAGGDGHTVAVDIKGNVYSWGASACGQLGLASM
KDLPTDVEGYPYQPTPRIIELLQSVKVIQIACGDAHTVALTQDGKLYSWGGGGCGQLGHP
DTSAMPKDEDGCPYQPKPKLIVVLKNLEVKQVACGKAHTVAVLNNGHLYSWGAGACGQLG
HPDTSSFPADEDGYPYQPIPRCVTALKPFKLIHASCGDVHTMVLTDQGEIYCFGGGSCGQ
LGFGNISQMPLDVDSCPFMPVPKKIESLQGIFIVSLSCGDSHSMALSREGHVYAWGEATY
GQLGLDDIRDLPKNTDNKPYQPFPQKVVALMNKKIVAISCGETHTLALTEGGHLYSFGGN
TCGQLGQYVKELEKGRGKKGGYEEIIFPKNSIESNPYSFMSNSDSPPDTPNERRDYSFNS
QHNMSHGGNTQMDDVSNPLNSPPSLFSPQDYGIDSLCMQPKLIKSLLPRKIIKISSGGVH
NICIVEPHPSSIMQDVYQSFMQSKYCDVVFKGFYTTVEIATNNTSTNAGQNQISGQSTNN
QNMIGGGSNTQSIISQTSNIGYHQQNNVGQNLMTANSNINEHNTINYIQATGQGLENSSD
EEMKEDFDMLDAQNDSSQALNSHQNVLNDQYWREKEKTIVNTKINAHKCIITHKSIYFAS
LFLERNSQFKITQQDDKLVIDFNGSVQYEAFRKIVDYIYLDDLNVLDAVADSTEMIEIIK
LAKQYNLESLFKACEVHFKELMVQSFDCSNLIALKYSGSGLAQSSQNPKALRKSTNKPLH
DLEQRDGNNVIRSSGRAVQQVSQSSGQSSKKNKKMQQKLNNMLQGLMFLPDGRVLIMDSE
LYKQTIDKSIVLDLFEGTSLNPNSPTQNQIAPLMNQQHQQQLQLPSQPYNQSQPPHINTN
HQLNQSSLEEEKQGGQPRINRENTNNSQQQQQQQQNKSKQNQANQRKKGNTNSNDQYGND
NQSITGGNGNNGGNTSMGMQQNVLDGSSSGSGGLEEFNDGKRDFLGMLNNSEFSDITLIV
DGNPIYCHQVVLASRSGYFEALFSHDFKEKEQKVVNFTDVSYDIFLTLLKHLYSDSLRIE
LKQVYDLLSLADRFSVASFKKKCEFILAQYINVENVCQIFKYANTFNCERLKESCLLFTE
ENHNEVIASSGFEDLDKDEILKIIRVGKESKRRFKGRH