Identifiers and Description

Gene Model Identifier

Contig18417.0.g27

Standard Name

KELCH87

Aliases

Contig18417_0_g27

Description

Regulator of chromosome condensation (RCC1) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13540 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam00415 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam07646 ) Kelch motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007180304.999617891954556e-16regulator of chromosome conden
sation (RCC1)
SGDYGL097W0.0000000010002658722841845SRM1 SGDID:S000003065, Chr VII
from 321782-323230, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18417.0.g27(coding)
ATGGTTAATCAACTCCAAAAACTCTTAAGAAAATTTTATCTAAGGATGTAACCTAAATTA
AATGTAATATTACAATTCATTAATACACTTTATTTAGAAACTTTTGAGAATCAAACAATT
TTATGTTATGGATCTCTGTCTCCACTCCTACATTTACAATTAATTCCAAGATCTGTTTCA
AATAAAACCAGAAGAGTGAAATAATTGGCTGTTGGTGAAGATCATGTGATTTTGCTGATG
CAAGATGGAGGTTTACTGGGTGTAGGTTCCAATTAGTACGGCTAGTTGGGCTTACCAATA
AATCGTCAAAATTAAGTTATACAAAGATTGAGAGATATACAGTTTCAAGGCCTTGATACA
ATTAAAAGCGAAACTATCAAAACTATTGTATCCGGACAATATCTCAGCATAGTAATGACA
TTGAATAAAGATAAATAGTAAAGAGTTTTGCAGTTTGGTAAAATCCCTGGCTCCTAAAAC
TTTCAGGAGGCCAATAACTACATTTTACAAGAAGTCATTTTTAAGCCTAATGTTTTGAAT
AAAGCAAATGAAATCGAAAAGGATATCCAAACTACAAAAATTAATAAGATATACTCAAGA
TATGACACAAATATAGCTATTGAAGGAAATAAGTTATATCTTTGGGGAGATAATCTCTCT
GGAACTATATTAACAAAGCCAGAACTAATCTGCTAATTTGATAAATAAATCCTCTAAATA
TCTGTAGGTTAAAAACATGGTTTAGTCCTAACGAAAGGAAGTTTAACTAGAAAGAATTAT
TTATATGGATGGGGTGATGGAACTTATGGAGAATTGGGTTTGTAATTCCAGGGAAGAAAT
TTGATAAAACCAGAGCTTCTGAATTATTTCGATGATCTATCTATCGCATAAATTGCAGTG
GGCGGGAGACACTCTTTAATTCTGGACGAGTAAGGGTAAATGTATGTGATGGGAGATAAC
TCAGCAGATTAATGTGCTACTACAGACAGAAGAGTGTATTTACCTCAAAAGATATTGTGT
GATGAACCTATTTAAGAGATATACTGTGGTTCTGAGCATAATGCAGCAGTTAATTACGAT
GAGGAAATATACTCTTGGGGTGGTACAGTTATTAATAAGGGATGGGGTAAGTAAAAGGAA
CAAGCAATCAGACTTGAACAGGTAGAAGATACTAAGCAAAGATAGATTAGCATGATTGAC
TTATCTTACTCCAACACTATTATAATAGCTACTTCAGATTGA


>Contig18417.0.g27(protein)
MVNQLQKLLRKFYLRMQPKLNVILQFINTLYLETFENQTILCYGSLSPLLHLQLIPRSVS
NKTRRVKQLAVGEDHVILLMQDGGLLGVGSNQYGQLGLPINRQNQVIQRLRDIQFQGLDT
IKSETIKTIVSGQYLSIVMTLNKDKQQRVLQFGKIPGSQNFQEANNYILQEVIFKPNVLN
KANEIEKDIQTTKINKIYSRYDTNIAIEGNKLYLWGDNLSGTILTKPELICQFDKQILQI
SVGQKHGLVLTKGSLTRKNYLYGWGDGTYGELGLQFQGRNLIKPELLNYFDDLSIAQIAV
GGRHSLILDEQGQMYVMGDNSADQCATTDRRVYLPQKILCDEPIQEIYCGSEHNAAVNYD
EEIYSWGGTVINKGWGKQKEQAIRLEQVEDTKQRQISMIDLSYSNTIIIATSD