Identifiers and Description

Gene Model Identifier

Contig16126.0.g93

Standard Name

KELCH84

Aliases

Contig16126_0_g93

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005024307.998842802738429e-74Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16126.0.g93(coding)
ATGTTGTGTCCAAACTGTCAATTAGAATTTAACTCAACAGTTTAAATACCCCGTATACTT
ATATTTTGTGGGCATACTTTTTGCCAAAGTTGCATTGAATCATTGCTTTAATAATCTACT
GATGAAGCTTAAGGTAAAACCTATTTGAACTGCCCAGAGTGCGATACCTAAAATGTTGCA
AATGATGGTATTAATTCTTTTCCAAAAAACTTAGTGCTCCTTCAAATGTACACCTAGATT
ACTAATCCATCTCAACAACCTAAACCCCAGAATAACAATGACAACAGTGGCTTAATCCAG
TAAAATTCCTTTCAAAATTAAATCCCCTCAAATGAAAATAAGCTATTAAGGGAAAGTTCG
CAAAAATCAAGCTCAAATGCATCATAACCATAGAATAACCATGATTTAAATTAGGTGAAA
GTACTGTGTAGTATTCATGGCAAGAAATTAGAGGCATTTTGTGAAAAAGACCTGCAAGTT
TTATGCATAGATTGCATTCTTTCAGATGCACATAAATCTCATGAAATTATTAGTGTACAA
AAGGCAGCTGAGAAACAAAGACAAATACTTTATGAGGAGGTAAATAATGCTCAAAAGACC
GAGGAAAAGTTAAGATTTATAATGTCTGATATTAGGAGGCATGTTAGTGAAATGCATTCA
ACAGCTGATAAAAATAGAAAGGAACTTTCCTCAATATATAGCTATGTGAGAGATTTAATA
TTGGAACGAGAGTAAACTTTAAAAAGATAAATTAGTGAAAATCTTACAAAAGAAGAGCAG
GAGAGTGAAGCCAAGTAAAGTGAAATTAATGACTTCATGGGAGGAATTAATTAGCTTAAA
TAAGAATTGTTTCAATAGAACCAAGAACATGATATCGATATACTCATCAAAGCAAAATAG
AGAGACTTGATATCAGGGGAAGTTAATGGATTAAGAGCAAGAGAATTGGTTTCTTTTAAT
ATACAAAGTGTCTCTAGTTGCTCACTTTCTTTGCAAGAAATAAAAAGAGAACAGGAACTA
AGTCAACTTAGTAAAATTATCAATCCCACTTATAAAGGTCCATCCATAGGTCAAACTATA
GGTGTCTCATCTAACCTTTATTCTCACACCGCATCTACAGCAAACAAAATGAAAAAGGCT
AATACTTAATTGCCTACTCAAGCAAGTAATAACTTCCCACTTGGTATTACAGGGGCTTAA
AATCCATTTCAAAATGAAAACAAACTTCAGAGAGAAGAAACTCGAAAAATTGGTAAAAGT
AACTAAAATGTTAGCAGTTCCCTCAATACAAATCAAGTAAAGACCAAAGTCAGCCCACAT
AGAGTTTAATAAAAGAAAGGAGATATAAGCTCAAACTAAAATAAGAAGCAGAATGTTATG
GTCCTGGATCAAAATAAGTAAAAATCAGCAAATACATAGCTCAATAAAAATTCAAGCAAG
TGCTAAGGCAGCTTTGGAAATATTGCAATGTAAAACTAGATCAATCTACATAATTTCAAT
CAATTTGGACATCATTAGTAAAGTACTTAGCCAACATTAGGCGCCTAACATGATGATTTG
ACGGAGGATTTGTTAGGGAACATGGGAGCAGAAGATGTTTCAAGTATTTATCCTTTAGAA
ACCAACGATTGTTACTTTTAATATCAAGGAGACAACCAGCAAAATCAAAAGTACACATTT
GCGAAGAGAGACGAATCAGTCGGAAACTTAAACGATTTGCTTGAGAGTCTTAACAAGAGT
TCCTCTGGTCAACAAGACCTCGGAGGTATTATTGATAATGATAAATAACTAGGTACTTCT
ACAGCTTCAGAAACAGGAGGGAGCCACTCTGATATCAACATCAAGACGCCACCCCCACAA
GACTTTAAACTCAAGCAAGTCAAAAGTTCTGTTGAAAGCCCCAAAATCAAGAAAGGCAAT
CCTTGGAAAAATCAGCCAGTTTAGCAAAAGAAGAAATCTGGAAAGAAAAACAACTTCAAG
AAAGACAATAGCACCACAGACCTGGATGAACTAAAGTCAAAACAATAAATAAGTAATAAC
TAGGAGGTTTATACTGCCTTAGAGGAGACCAAGAATGAAATTAGATCAGGGAGTCTATAG
AGATATGGAAATAATGGGATTTTAGATAATGACAACTAAAATTCAATAAGTAAGAAACAC
AACTACTAGAATCTAAAGAATGAAGATAATGACAATAAAAGACATAAATTCTCATAATAG
AATGAATTTAACAATAATCACTAAATGTGCAGCCTTTCTTAAGAAAGAGCCAAAAGAAAG
CAAATGAAAATGGGATTATAGTCATAAGAGTAAAGTCCATGTAAAATTGAAAAAGTAAAT
GCCAAAGATAATGCTATTATGGAAATGCTTCAAGAATGCACTAAAAACATCGACAAACTT
GAGTTCAGACCAACTTAAATGAAGCAATAAAACCTGAAAACTAACAGTACCTAAGAGTCA
CCTATAAAACTTGTATCTTAAAACTCAGGCAAAGCAGCGGTCTGTGTAGTAGATCTAACA
AGAAGAGATGACATTGAAGAGTTCAATGTGAGAAAGAATGAAGATAAAGATTAGATTTGT
TATAACGAGGAAGAAGAGGGTACCCACTTAAAGAATATACCAAATATGACTAAACCTAAA
GATCAATCACCTTTGAAGAAGCAGTTTGAAAGATAATAATCAAGTTCAAACTCACCTAAT
AAGAAGCTGAATATGTTAAAATCTACTGAAAGTCTAGATAACTTGATGGTTTAAGTTATA
AAAAATTAAGATACTTCACTTGAAATTTCAAGAACTAACTAGTTAAACTTTGGATCAGAG
ACATTTCTGCAGTAAAGTGTTTCAGTGGACACAAGTGTTAGTGATCCATTTAGAGCTTTC
TGCAAAATTAGGGAGGAATTTATCTTTGTGTTTTCTGGCTTTAACGATTAAAAATTGCTT
ACTTGTGAGGCATTAGATGTCTAGAGAGGTACTTGGAAGGAAGTTTGTCAAATAGGAAAG
GCAAGAACGAAATTTTCTGCAGTTCCTATTTCAAAATCTCGTATCTTGATCTTCGGTGGC
AAGCAAGCAGATGGACAGAGAACTGGAGAGATTGAAGAATACAACTTAAAAACCAATAAG
TTTAAGACTCTTCCTTTTAAGTTGCCCAAACCTAGATCTGGATTTTCATCTTGTGTAAAG
AGAGAAGAAGGTAAAATATTTTTCTGTGGAGGAAATAGCGGCAGTGTATTGAAGAAATTC
GATTGCCTAGATTTAAAGAAGGGGAAATGGAGTAGATGGCCTGAAATGATATAGAAAAGA
GATGAACTTGCAGTTGCTTTGGGGCCAGATGGCAAGATATATGCGATAGGTGGCTATGGC
GGAGGAAGTGCTAGTAATTCAACATAATAGACCATTGAAGATAATAAAGATAACAACTCA
ACAAAGGGAACTAGTAATCAGACATCAAACTGCTTGAGAACAGCTGAAAGATTTGATTTC
AACACAGGTGAATGGGAAATGCTTCCAGAGATGAATGAAGCCAGAAGAGCCTTAGCTGCT
GTGGCTCTACCGGACGGAATATATGCTATTGGAGGCTACGACGGTAAATAATATCTATCA
TCCGTTGAAAAATTTGATTTGTAAAAGCAGCAATGGATACCAGTCAAGAGCATGAATACA
AGCAGATGCACTCTATCTGCGGCAGTGAGTAGCGATTGTTAGTACATCTATGCGATAGGC
GGCTTCAACGGAAACTCACTAGATTTAGTGGAGAGATACAATACAATGACAGATGAGTGG
GAATTTATGACTCCAATGATCTCTAAGAGATTTATGCATGAAGCAGTTTGCTTAGTCACA
CATTGA


>Contig16126.0.g93(protein)
MLCPNCQLEFNSTVQIPRILIFCGHTFCQSCIESLLQQSTDEAQGKTYLNCPECDTQNVA
NDGINSFPKNLVLLQMYTQITNPSQQPKPQNNNDNSGLIQQNSFQNQIPSNENKLLRESS
QKSSSNASQPQNNHDLNQVKVLCSIHGKKLEAFCEKDLQVLCIDCILSDAHKSHEIISVQ
KAAEKQRQILYEEVNNAQKTEEKLRFIMSDIRRHVSEMHSTADKNRKELSSIYSYVRDLI
LEREQTLKRQISENLTKEEQESEAKQSEINDFMGGINQLKQELFQQNQEHDIDILIKAKQ
RDLISGEVNGLRARELVSFNIQSVSSCSLSLQEIKREQELSQLSKIINPTYKGPSIGQTI
GVSSNLYSHTASTANKMKKANTQLPTQASNNFPLGITGAQNPFQNENKLQREETRKIGKS
NQNVSSSLNTNQVKTKVSPHRVQQKKGDISSNQNKKQNVMVLDQNKQKSANTQLNKNSSK
CQGSFGNIAMQNQINLHNFNQFGHHQQSTQPTLGAQHDDLTEDLLGNMGAEDVSSIYPLE
TNDCYFQYQGDNQQNQKYTFAKRDESVGNLNDLLESLNKSSSGQQDLGGIIDNDKQLGTS
TASETGGSHSDINIKTPPPQDFKLKQVKSSVESPKIKKGNPWKNQPVQQKKKSGKKNNFK
KDNSTTDLDELKSKQQISNNQEVYTALEETKNEIRSGSLQRYGNNGILDNDNQNSISKKH
NYQNLKNEDNDNKRHKFSQQNEFNNNHQMCSLSQERAKRKQMKMGLQSQEQSPCKIEKVN
AKDNAIMEMLQECTKNIDKLEFRPTQMKQQNLKTNSTQESPIKLVSQNSGKAAVCVVDLT
RRDDIEEFNVRKNEDKDQICYNEEEEGTHLKNIPNMTKPKDQSPLKKQFERQQSSSNSPN
KKLNMLKSTESLDNLMVQVIKNQDTSLEISRTNQLNFGSETFLQQSVSVDTSVSDPFRAF
CKIREEFIFVFSGFNDQKLLTCEALDVQRGTWKEVCQIGKARTKFSAVPISKSRILIFGG
KQADGQRTGEIEEYNLKTNKFKTLPFKLPKPRSGFSSCVKREEGKIFFCGGNSGSVLKKF
DCLDLKKGKWSRWPEMIQKRDELAVALGPDGKIYAIGGYGGGSASNSTQQTIEDNKDNNS
TKGTSNQTSNCLRTAERFDFNTGEWEMLPEMNEARRALAAVALPDGIYAIGGYDGKQYLS
SVEKFDLQKQQWIPVKSMNTSRCTLSAAVSSDCQYIYAIGGFNGNSLDLVERYNTMTDEW
EFMTPMISKRFMHEAVCLVTH