Identifiers and Description

Gene Model Identifier

Contig16127.0.g90

Standard Name

KELCH82

Aliases

Contig16127_0_g90

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005024309.99711830094262e-74Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16127.0.g90(coding)
ATGTTGTGTCCAAACTGTCAATTAGAATTTAACTCAACAGTTTAAATACCCCGTATACTT
ATATTTTGTGGGCATACTTTTTGCCAAAGTTGCATTGAATCATTGCTTTAATAATCTACT
GATGAAGCTTAAGGTAAAACCTATTTGAACTGCCCAGAGTGCGATACCTAAAATGTTGCA
AATGATGGTATTAATTCTTTTCCAAAAAACTTAGTGCTCCTTCAAATGTATACCTAGATT
ACTAATCCATCTCAACAACCTAAACCCCAGAATAACAATGACAACAGTGGCTTAATCCAG
TAAAATTCCTTTCAAAATTAAATCCCCTCAAATGAAAATAAGCTATTAAGGGAAAGTTCG
CAAAAATCAAGCTCAAATGCATCATAACCATAGAATAACCATGATTTAAATTAGGTGAAA
GTACTGTGTAGTATTCATGGCAAGAAATTAGAGGCATTTTGTGAAAAAGACCTGCAAGTT
TTATGCATAGATTGCATTCTTTCAGATGCACATAAATCTCATGAAATTATTAGTGTACAA
AAGGCAGCTGAGAAACAAAGACAAATACTTTATGAGGAGGTAAATAATGCTCAAAAGACC
GAGGAAAAGTTAAGATTTATAATGTCTGATATTAGGAGGCATGTTAGTGAAATGCATTCA
ACAGCTGATAAAAATAGAAAGGAACTTTCCTCAATATATAGCTATGTGAGAGATTTAATA
TTGGAACGAGAGTAAACTTTAAAAAGATAAATTAGTGAAAATCTTACAAAAGAAGAGCAG
GAGAGTGAAGCCAAGTAAAGTGAAATTAATGACTTCATGGGAGGAATTAATTAGCTTAAA
TAAGAATTGTTTCAATAGAACCAAGAACATGATATCGATATACTCATCAAAGCAAAATAG
AGAGACTTGATATCAGGGGAAGTTAATGGATTAAGAGCAAGAGAATTGGTTTCTTTTAAT
ATACAAAGTGTCTCTAGTTGCTCACTTTCTTTGCAAGAAATAAAAAGAGAACAGGAACTA
AGTCAACTTAGTAAAATTATCAATCCCACTTATAAAGGTCCATCCATAGGTCAAACTATA
GGTGTCTCATCTAACCTTTATTCTCACACCGCATCTACAGCAAACAAAATGAAAAAGGCT
AATACTTAATTGCCTACTCAAGCAAGTAATAACTTCCCACTTGGTATTACAGGGGCTTAA
AATCCATTTCAAAATGAAAACAAACTTCAGAGAGAAGAAACTCGAAAAATTGGTAAAAGT
AACTAAAATGTTAGCAGTTCCCTCAATACAAATCAAGTAAAGACCAAAGTCAGCCCACAT
AGAGTTTAATAAAAGAAAGGAGATATAAGCTCAAACTAAAATAAGAAGCAGAATGTTATG
GTCCTGGATCAAAATAAGTAAAAATCAGCAAATACATAGCTCAATAAAAATTCAAGCAAG
TGCTAAGGCAGCTTTGGAAATATTGCAATGTAAAACTAGATCAATCTACATAATTTCAAT
CAATTTGGACATCATTAGTAAAGTACTTAGCCAACATTAGGCGCCTAACATGATGATTTG
ACGGAGGATTTGTTAGGGAACATGGGAGCAGAAGATGTTTCAAGTATTTATCCTTTAGAA
ACCAACGATTGTTACTTTTAATATCAAGGAGACAACCAGCAAAATCAAAAGTACACATTT
GCGAAGAGAGACGAATCAGTCGGAAACTTAAACGATTTGCTTGAGAGTCTTAACAAGAGT
TCCTCTGGTCAACAAGACCTCGGAGGTATTATTGATAATGATAAATAACTAGGCACTTCT
ACAGCTTCAGAGACCGGAGGAAGTCACTCTGATATCAACATCAAGACGCCACCCCCACAA
GATTTCAAACTCAAGCAAGTCAAAAGTTCTGTTGAAAGCCCCAAACTCAAGAAAGGCAAT
CCTTGGAAAAATTAACCAGCTTAGCAAAAGAAGAAATCTGGAAAGAAAAACAACTTCAAG
AAAGATAATAGCACCACAGACCTGGATGAACTCAAGTCAAAACAATAAATAAGTAATAAC
TAGGAGGTTTATACTGCCTTAGAGGAGACCAAGAATGAGATTAGATCAGGGAGTCTATAG
AGGTATGGAAGTAATGGAATTTTAGTTAATGACAATTAAAATTCAATAAGTAAGAAACAC
AACTAATTCAATCTAAAGAATGAAGATAATGACAATAAAAGACATAAATTATCATAGTAA
CAAAATGAATATAACATGTGTAGTCTTTCATAGGAAAGAGCTAAAAGAAAGTAAATGAAA
ATGGGAATATAATCATAAGAGTAAAGTCCATGTAAGATTGAAAAAGTAAATGCCAAAGAT
AATGCTATTATGGAAATGCTTCAAGAATGCACTAAAAACATCGATAAACTTGAGTTCAGA
CCAACCTAGATGAAACAATAAAACTTGAAAACTAACAGTACCTAAGAGTCACCTATAAAG
CTAGTATCTTAAAACTCAAGCAAAGCAGCTGTATGTGTTGTGGATCTAACAAGAAGAGAT
GACATTGAAGAGTTCAATGTGAGAAAGAGTGAAGATAAAGACTAGATTTGTTATAACGAG
GAAGAGGAGGGCACACACTTGAAGAATATTCCAAATATGACTAAACCTAAAGATCAATCG
CCCTTGAAGAAGCAGTTCGAAAGATAATAATCAAGCTCAAATTCTCCCAATAAGAAGCTG
AATGTGCTAAAATCAACTGAAAGTCTAGATAACTTGATGGTTTAAGTTATTAAGAATTAA
GATACATCACTTGAAATTTCGAGAACTAACTAATTAAACTTTGGCTCAGAGACGTTTCTT
CAGTAAAGTGTTTCAGTTGATACAAGTGTTAGTGATCCATTTAGAGCTTTCTGTAAAATT
AGGGAGGAATTTATCTTTGTGTTTTCTGGCTTTAACGATTAGAAATTACTTACTTGTGAG
GCTCTAGATGTGTAGAGAGGTACTTGGAAGGAAGTTTGCTAAATAGGAAAAGCAAGAACG
AAATTTTCAGCAGTTCCTATCTCGAAATCTCGTATCTTGATCTTCGGTGGTAAGCAAGCT
GACGGACAGAGAACTGGAGAGATCGAAGAATACAACTTAAAAACCAATAAATTTAAGACT
TTGCCTTTTAAATTGCCCAAACCTAGATCTGGTTTTTCATCTTGTGTAAAGAGAGAAGAA
GGTAAAATCTTTTTCTGTGGAGGAAACAGCGGCAGTGTATTGAAGAAATTTGATTGCTTA
GATTTAAAGAAGGGAAAGTGGAGTAGATGGCCTGAAATGATATAAAAGAGAGATGAATTG
GCAGTTGCTCTGGGACCAGATGGCAAGATATATGCAATAGGTGGCTATGGAGGAGGAAGT
GCTAGCAATTCAACACAATAGACAATTGAAGATAATAAAGATAACAACTCAACAAAGGGA
AGTGGTAACCAGACTTCTAACTGCTTGAGAACAGCTGAAAGATTTGATTTCAACACAGGC
GAATGGGAAATGCTTCCTGAGATGAATGAAGCCAGAAGAGCCTTAGCAGCTGTGGCTCTA
CCAGACGGTATATATGCTATTGGAGGCTACGATGGTAAATAATATCTTTCATCCGTTGAA
AAATTTGATTTGCAAAAGCAGCAATGGATACCTGTCAAGAGTATGAATACAAGCAGATGC
ACTCTATCTGCAGCAGTGAGCAGCGATTGTTAGTATATCTATGCGATAGGTGGCTTCAAC
GGAAACTCACTAGATTTAGTGGAGAGATACAATACAATGACAGATGAGTGGGAATTCATG
ACTCCGATGATCTCTAAGAGATTTATGCATGAAGCAGTTTGCTTAGTCACACATTGA


>Contig16127.0.g90(protein)
MLCPNCQLEFNSTVQIPRILIFCGHTFCQSCIESLLQQSTDEAQGKTYLNCPECDTQNVA
NDGINSFPKNLVLLQMYTQITNPSQQPKPQNNNDNSGLIQQNSFQNQIPSNENKLLRESS
QKSSSNASQPQNNHDLNQVKVLCSIHGKKLEAFCEKDLQVLCIDCILSDAHKSHEIISVQ
KAAEKQRQILYEEVNNAQKTEEKLRFIMSDIRRHVSEMHSTADKNRKELSSIYSYVRDLI
LEREQTLKRQISENLTKEEQESEAKQSEINDFMGGINQLKQELFQQNQEHDIDILIKAKQ
RDLISGEVNGLRARELVSFNIQSVSSCSLSLQEIKREQELSQLSKIINPTYKGPSIGQTI
GVSSNLYSHTASTANKMKKANTQLPTQASNNFPLGITGAQNPFQNENKLQREETRKIGKS
NQNVSSSLNTNQVKTKVSPHRVQQKKGDISSNQNKKQNVMVLDQNKQKSANTQLNKNSSK
CQGSFGNIAMQNQINLHNFNQFGHHQQSTQPTLGAQHDDLTEDLLGNMGAEDVSSIYPLE
TNDCYFQYQGDNQQNQKYTFAKRDESVGNLNDLLESLNKSSSGQQDLGGIIDNDKQLGTS
TASETGGSHSDINIKTPPPQDFKLKQVKSSVESPKLKKGNPWKNQPAQQKKKSGKKNNFK
KDNSTTDLDELKSKQQISNNQEVYTALEETKNEIRSGSLQRYGSNGILVNDNQNSISKKH
NQFNLKNEDNDNKRHKLSQQQNEYNMCSLSQERAKRKQMKMGIQSQEQSPCKIEKVNAKD
NAIMEMLQECTKNIDKLEFRPTQMKQQNLKTNSTQESPIKLVSQNSSKAAVCVVDLTRRD
DIEEFNVRKSEDKDQICYNEEEEGTHLKNIPNMTKPKDQSPLKKQFERQQSSSNSPNKKL
NVLKSTESLDNLMVQVIKNQDTSLEISRTNQLNFGSETFLQQSVSVDTSVSDPFRAFCKI
REEFIFVFSGFNDQKLLTCEALDVQRGTWKEVCQIGKARTKFSAVPISKSRILIFGGKQA
DGQRTGEIEEYNLKTNKFKTLPFKLPKPRSGFSSCVKREEGKIFFCGGNSGSVLKKFDCL
DLKKGKWSRWPEMIQKRDELAVALGPDGKIYAIGGYGGGSASNSTQQTIEDNKDNNSTKG
SGNQTSNCLRTAERFDFNTGEWEMLPEMNEARRALAAVALPDGIYAIGGYDGKQYLSSVE
KFDLQKQQWIPVKSMNTSRCTLSAAVSSDCQYIYAIGGFNGNSLDLVERYNTMTDEWEFM
TPMISKRFMHEAVCLVTH