Identifiers and Description

Gene Model Identifier

Contig22648.0.g101

Standard Name

KELCH80

Aliases

Contig22648_0_g101

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • regulation of transcription, DNA-templated (IEA) | GO:0006355
  • regulation of sporulation resulting in formation of a cellular spore (IEA) | GO:0042173

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069709.99723014177113e-33Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22648.0.g101(coding)
ATGGAGTCTATATTCGAGTGTGGCGTGTGCTTTAAAACTTACAATCACTCAGAAAAGAAG
CCCTTGTCCCTGCCCTGTGGACATACCTTCTGCTTGGAATGCTTAAAACAAATTAATAAA
CACTCTATTATCAAGTGTCCCTTTGACAAGATTGCTCATCACACTATTGCTGAGAATCTC
CCTGTTAATTACGCAGTCCTGACAGCCCTCCCAATGACAAGCCAGAGCCCAGGTTCCGGA
GACAGTGGGTAGAAGCAGCCGAATTAGGCTATGTGTGACATTCACAAAAACAAGAAGATA
AAGTTCTTCTGCAAAAGTGACTAAGAAATGTTCTGCTCAAAATGTGTCCTCAGACATACT
AATGCAAAACACGATGTTCAGCCATGTTCCTACAAAATTTTGGACATGAAAAGACTTGTA
AAAGAAATGCTTGAAGAAGTAGAATAAGTCGACAGAAATAACAATGTCTGTGAAGAGCTC
TATGGAAAACTTGAGCAGAAAGTTAAAAAGAAGTTTCATGAGGAAGTCGACAGATTAGAG
AAATCCTTCAGAAGAATAATCGAACAACTTGAAATATAACAATAAAATCTCTATACTATG
ATGAAAGAATAAATCGACAAGGAGCTTAAATGCCTTACTGAGAAGAAGAAAAAAGTCAAA
GAAAGGGACGAAGCTATTGTTCAAAATCGATAGGATTTAACTGTCGCACTAAATAACATG
GAGTACTACTCAGACGACATGACTTTTAATACATATTTTGAGAAAAAGAAGAGAGATCTA
AAGGTTTTGTCAGTCTTGAATGATTTTATAAAGCCAAATCCTTACTTTGTGTATTATATG
TTCAAAGATTCTATTCATGTAGATGATTATGGCTCAATTAAAGAAACTTTATTCAAGTTC
CCACAAATGACAAGAAACTCTTCAAATTAAGCAAATATCTATCTCTTTGGTGATGACGTG
AATTCAAAAGTCTCATTATGTTATGATGTTAATGAAGACGAATGGACAATGAAGAAACTT
CCAGATACATCCTAGTAGAAATTTTATTAATGCTCGGCAGCAATAGCTCTCTCACCAATC
GAAATTTTGATTACTGGAGGAGGTTCACCACCTAAAAAAGATTCAAGGTTATATTTGACC
TAGAAGAATGACATCGTTCCAAAGGCCATGATGAATGAAAGTAGAAATGCCCATGCAATT
ACTTTATGTAAAGGAGCAGTGTTTGTATTGGGAGGTTTCTCAGGGAAATAAAGACTTAAT
TCTGTTGAGAGATATTCAGTAAAAGAAGATAAATGGACACCTATGGCACCTATGAAGGAC
AAAAGACATTACCTGAGTGCATGCGCAGTGAATGATGAATTCATCTATGCATTTGGAGGC
TTTTTTGGAAGTACCGAACAAGAAATAAATGATTCAATTGAAGTCTATGAGGTAGAAAAG
AACATCTGGTCAGTGCTCACAGTAAGAATGAAAAATGCTCTGTGGGCTTGTAGTGCTCTA
TCAATATCCCCATCCGAGATTATTCTCATTGGAGGAAAAAATACCAACAGAAATGGTGAG
GTCAATTTGTTCAACGTTCAAACTAAGCAATGGAAGTAGTTACACAACATGAACTAACTC
AGAGTTTCTCACAAGTCATTCTACATGCAAGGCAAAATATACGTAATAGGCGGTGACTAT
GAGATGAGTTGTGAAGTCTACGATCTAAAAGAAAACAAGTGGAGCTTCATAAGTTCTTAT
AATTCATTGCTTGGCAATTCTCTCTACTCTTTCTCGTCAGCAATGGCAGTTCTAGAGTGA


>Contig22648.0.g101(protein)
MESIFECGVCFKTYNHSEKKPLSLPCGHTFCLECLKQINKHSIIKCPFDKIAHHTIAENL
PVNYAVLTALPMTSQSPGSGDSGQKQPNQAMCDIHKNKKIKFFCKSDQEMFCSKCVLRHT
NAKHDVQPCSYKILDMKRLVKEMLEEVEQVDRNNNVCEELYGKLEQKVKKKFHEEVDRLE
KSFRRIIEQLEIQQQNLYTMMKEQIDKELKCLTEKKKKVKERDEAIVQNRQDLTVALNNM
EYYSDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKF
PQMTRNSSNQANIYLFGDDVNSKVSLCYDVNEDEWTMKKLPDTSQQKFYQCSAAIALSPI
EILITGGGSPPKKDSRLYLTQKNDIVPKAMMNESRNAHAITLCKGAVFVLGGFSGKQRLN
SVERYSVKEDKWTPMAPMKDKRHYLSACAVNDEFIYAFGGFFGSTEQEINDSIEVYEVEK
NIWSVLTVRMKNALWACSALSISPSEIILIGGKNTNRNGEVNLFNVQTKQWKQLHNMNQL
RVSHKSFYMQGKIYVIGGDYEMSCEVYDLKENKWSFISSYNSLLGNSLYSFSSAMAVLE