Identifiers and Description

Gene Model Identifier

Contig9388.0.g31

Standard Name

KELCH79

Aliases

Contig9388_0_g31

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008492500.00000008001913847069386Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9388.0.g31(coding)
ATGAACTAACTCACTCAAGACATCAAGAAGATTCCAAAGTCAGACCAAGTCGTCAAAGTC
AATTCCAAGAAATTTGATGAGAAACTCCCTTCAAAAAACCTTGTTAAGGTTTGTCACTAA
CTTGCTTTGAGAAGCCAAGCTATCTGTGTGGTAGTTTCATACCTAACTCAAGAGAAGAAA
ATGCTCATTCAACAAGCATGTCAGCATTTCTATCAGAAAATCGTTCCTCTATCTATGTCA
GATTTAACTCAACCTCGATTCTATTAACCTATGTACTTTGAAGACAATAATTTTCTTTAC
TTCCTCGACACATGTGATTTGATTACTTAAGGTCAGGATCAGCTAAACTCAAAGGCCCGG
GTAAGCTCTCATTATAAATCTGAGAAGAACGGAGATGCAAACAACTAAGCAGATGCAGAT
GATGCTGAAAGACTGATCAAGAAAAAGGTCAAGTGGGTGAAAATAGGAGAAATTCAAGGT
TTGCGAAAAGTGTTCATCAATAATGTATCATACTCGGCATTTGTCTACCGTTCCCTGTGC
ATTACTCCACAGAAGAGACTGTTTCTAATAGGTGGCATTAAAAGACAAGATGATTATTAA
AGTGAGTAAAAGGTACCAATCACTGAGACAGTTGAGGTTAAGATTGATTTCGGAAGACAC
AAAAAAATTCCTCGAGCTGTTGTGAAATCTTCTATGATCAACCCCAGATGCACTCAATCT
ATGACATCAATACTGAACGGCAAGTACATCGCTGTTGCTGCTGGTGCTCTTGAAGACAAG
AAACAGACTGATACTTGCGAGTACTATGATACTGAGAAAGATATCTGGCATCCATTGCCC
AAGCTCAACTTCGAGAAATTTCAGGCATCTTTAGTTAATGTCGCGGACAAGTACTTATAT
TATCTGGGAGGATAATCATTGCATGTTAACTCAAATAAATTTACTAGCACTATCGAACGT
CTCAACTTCCTAAAGTGGAGTGCCTAGAACCTCATTTACTTCTCACAGAATGACGACCCA
ACTCAAAGTGGTTTTATTTAGGACGTGATTGGAGAGTAAAGATGGGAGGTGCTAGAAGTA
AGATGCCCAGACAGGTTTACTTTAGGATTTACATTTTCCTTAGGCTTCTACCGCAGGGCT
ATCAGGCGTGACTACTACAACGGATTGAACTCTGGCAAGATCGTTGAGTGTGACTTAGAG
TGGAAGGATGGAAAGCTTACTTTTGCAGCTAATGATTAAGATGTGTACTCAAAAATGCTC
TCAGACTACCCAGGCATAGTGAAGGGATCATTGGAAGATTAAGGTCCTGCTCTATACTCT
GAGGATGACTACGACTTGAGGTGCCCTTCTGGACTCAGGAACTCTCGCCTTTATGATGAA
CGCATCTACGTGCTCGGAGGGTTGGGTCAAAACTTCAGACAAATCCATTTTCTTGATTTG
TTCAAAAAGGAGTACGTTAGCTCTGGGATTATAGAGGAAAACCCTAATGATGTAGACTAT
ATACTCGATGACAATTACTGTATATTTGATTATGGAAGGAGAATTATGTCAATCGGGAAA
TTCCACATTATAGAGATAGAAATTGGTGAGAAGCCAAAAGTTGTGACCTATCCTGATGGA
TACAAGAAAATCCAACACGACAGTATAAAGTAAGAGAATGAGATTGAGTGA


>Contig9388.0.g31(protein)
MNQLTQDIKKIPKSDQVVKVNSKKFDEKLPSKNLVKVCHQLALRSQAICVVVSYLTQEKK
MLIQQACQHFYQKIVPLSMSDLTQPRFYQPMYFEDNNFLYFLDTCDLITQGQDQLNSKAR
VSSHYKSEKNGDANNQADADDAERLIKKKVKWVKIGEIQGLRKVFINNVSYSAFVYRSLC
ITPQKRLFLIGGIKRQDDYQSEQKVPITETVEVKIDFGRHKKIPRAVVKSSMINPRCTQS
MTSILNGKYIAVAAGALEDKKQTDTCEYYDTEKDIWHPLPKLNFEKFQASLVNVADKYLY
YLGGQSLHVNSNKFTSTIERLNFLKWSAQNLIYFSQNDDPTQSGFIQDVIGEQRWEVLEV
RCPDRFTLGFTFSLGFYRRAIRRDYYNGLNSGKIVECDLEWKDGKLTFAANDQDVYSKML
SDYPGIVKGSLEDQGPALYSEDDYDLRCPSGLRNSRLYDERIYVLGGLGQNFRQIHFLDL
FKKEYVSSGIIEENPNDVDYILDDNYCIFDYGRRIMSIGKFHIIEIEIGEKPKVVTYPDG
YKKIQHDSIKQENEIE