Identifiers and Description

Gene Model Identifier

Contig7807.0.g35

Standard Name

KELCH75

Aliases

Contig7807_0_g35

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669100.00000000030007160092483236Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7807.0.g35(coding)
ATGAAGCTAATGAACGAGAAAAGAGAGCAATTTGAGTCTTTAATAGAGTCTAAGATGGAG
AAAGTACTCAGAAAGATTGAAAACATTGACAAGCACAAGTTAAGTACCTATGATTAAATT
GACAAGTACTTCGAAGAGCTAATAAAAAAAGCAAAACAAAGATGCTAAGCTCTTAAGTCT
GAATTCGATAAGATAGAGTTAAAAGAGAAATAAAGACTAGATTAAATCAAAGAGAAAATT
GATAGAGACTTGGAATAGGTCAAAACTTTCTCAACTGGATTCCTCCAATTTTTCTATCAT
TTCGATGAACAGAGTGATTTCAATTCTAATAAAGCTACTTACTCTAAGTTCCTCAGAGAT
TTGGAAAAAATTAAGGATTCTTCTTAGAAAAAACCTTATTACTTTAAGTTGCCCAAGCAT
TCTCCTACACTTTTTAACACTATCGATACTGATCTCAATCTTATCGACAAGATGGGCAAA
ATAATGGACAATTCCAGCGTGTAGACTCCCCTCGTAGTATTTAACACTTAATAGTTTGGC
CTATTTGAGTACCGAGAGAAGGCCCATGGTTTTGTATAGTTGCCAATCGTAGACGAGGAA
AATCTCTCAGAAAAAATGCCTAAGAACTTTAAATCAGTATATATTGGCAATGAAAGTTTC
TTCATAGCTGGAGGATTTGATGCTAAAGCTGCAAAATCTTCAAAGAGAGCATTTCTGTTG
ACTAGAGGCAAGATACAAGATATTATGGAAATGTACAAAGCGAGATATATAAATAAAGGG
CAAGCCTTAGATAATGTTGAAAAGTACTCATTGGATAAAAAAGAGTGGGAATAAGTGGCT
AGTCTAAACCACAGAAGAATAAATAGTGGAGCTTGTACAGTTGGCAACAACCATATTTTT
GTTTTTGGAGGTAGAAATGAGACTGATGTCTTTTATGACTCAGTTGAGAGACTGAACATA
GAATTGAATCTTTGGAATCTACTAAAAGTCAAACTGCCTAGAAAATTGTGCAATGTTATG
GCTTTTACATTTCAAAAAGATTACATCGTAATATTAGGAGGTTTGAAAAAATTTTAAGGC
GGAATAGGAGGCAGTAACGAAGAAAAAGATGCTCTTATGAAAAAGAAATCTGGAGATAAA
AATAAAACACCAGAAATTTAACAGATACCTGAGTATGAAATTGAAAGGAATGTTTATCTC
TATAATCAATCGAAAGATACTTGGTTTTAATTGAAATCTCTCCCTCAGAAACATAAGATA
TGCAATGCGGTACACAATGAAAACGGCAAATTCTACTTGTTTTTGTTGGATTAGAATACC
AAGTCAGATCTCCCCATAAACTTAGTTTACGATTTGAAGAATTAGTGCCCCAAACTGGAT
AGATTTTGGAATCATGAATACATGATGAGGGCTATGGAGTCGAGGAAGCAGTAAATGACT
AATGATATATTTATCAGTGATAGAAGTAATAAGCATGGTAGCAGAAGGGATTTGGATCCC
TACTAAAAAGCAATTGACTCAAAACTATCTCAGGGTCAAGCACAGGCAATGACTGCAGAC
CTCCGACAATCAATTATGAACCAAGAAAATTCTCAAATTGTATTTGGAAACAACAAAAAC
TCAATCAATCAACACCCCTCAAACCTTTAGAACGCTAACAACTAAATAAACTTGCAACAC
CAGCATATTTTAGGTTAATCAGTACAAATCCAGTAGAAAAAAGAACCTTAAGTTTTTGAG
TTGAAGGAAATAAATAGTGCCATGAATATAGGACTCGATGGGTAGAGAGACAACGATCTT
GATCAATTGCTAAACGATAATAACTAGCATTATGGCAAATAAAAAGACAGAGGTTTCAAA
GACTTCGATGATGATCTGGCTTTAGATATGCTCAAACTTGAAGACAATTTCTCAAGAATT
AATGAGAGTAGTTTCTTGAAAGACTTACCACCATAATTCCTAGGAGGAGGCAGCAGTAAT
ACCAATTAATAATAGCAGATGCATCAGACTAGAAACTCTATAATATCGAATACCCCATCA
ATGCAAATGAGGCAGCAAGCAAGCATGAACCAGTAGCAACAGCAGCAAATGTGGGATAGG
CAATCACAATACAACAACAATTAAATAGGAAATAATAGCAACTACATGGGTTATGCTGGA
GGAGGTAACAGCCAATATAATGGTGGTGGGCAGGGTAATTAAACTCAAAGATCCTCAATT
CTCAATAACAGCAATAACTACTACAACCAGGCGCCAATGGGTTTCAACAGAGGTCAAACC
AATCTGTACCAAAACAATCTAAATAATCACAACTTCCCATTCGATAGAATTCCAGATTCT
ACAACTAACAGAGGAGGAGATTCTTAAACTTACAAAAATTACAACAATAATTATGGTACA
AATGGGAGTTAGACAATTAGGGGAGTCAATCATTTTGACAATAATTTCAACAATTTTAAT
GATGACTTCTTTGGAGAAGATCTCCAGAGCTACCCAAGAAGAATTGGAGGTGGTCAATAA
AATATCCAAGAACTAGGTACACCACTTGGAAGTTTCAAGAATTCGAGATTATTTAGTGAT
GATGGTAATGATAAATTCTGA


>Contig7807.0.g35(protein)
MKLMNEKREQFESLIESKMEKVLRKIENIDKHKLSTYDQIDKYFEELIKKAKQRCQALKS
EFDKIELKEKQRLDQIKEKIDRDLEQVKTFSTGFLQFFYHFDEQSDFNSNKATYSKFLRD
LEKIKDSSQKKPYYFKLPKHSPTLFNTIDTDLNLIDKMGKIMDNSSVQTPLVVFNTQQFG
LFEYREKAHGFVQLPIVDEENLSEKMPKNFKSVYIGNESFFIAGGFDAKAAKSSKRAFLL
TRGKIQDIMEMYKARYINKGQALDNVEKYSLDKKEWEQVASLNHRRINSGACTVGNNHIF
VFGGRNETDVFYDSVERLNIELNLWNLLKVKLPRKLCNVMAFTFQKDYIVILGGLKKFQG
GIGGSNEEKDALMKKKSGDKNKTPEIQQIPEYEIERNVYLYNQSKDTWFQLKSLPQKHKI
CNAVHNENGKFYLFLLDQNTKSDLPINLVYDLKNQCPKLDRFWNHEYMMRAMESRKQQMT
NDIFISDRSNKHGSRRDLDPYQKAIDSKLSQGQAQAMTADLRQSIMNQENSQIVFGNNKN
SINQHPSNLQNANNQINLQHQHILGQSVQIQQKKEPQVFELKEINSAMNIGLDGQRDNDL
DQLLNDNNQHYGKQKDRGFKDFDDDLALDMLKLEDNFSRINESSFLKDLPPQFLGGGSSN
TNQQQQMHQTRNSIISNTPSMQMRQQASMNQQQQQQMWDRQSQYNNNQIGNNSNYMGYAG
GGNSQYNGGGQGNQTQRSSILNNSNNYYNQAPMGFNRGQTNLYQNNLNNHNFPFDRIPDS
TTNRGGDSQTYKNYNNNYGTNGSQTIRGVNHFDNNFNNFNDDFFGEDLQSYPRRIGGGQQ
NIQELGTPLGSFKNSRLFSDDGNDKF