Identifiers and Description

Gene Model Identifier

Contig17944.0.g95

Standard Name

KELCH74

Aliases

Contig17944_0_g95

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007907602.999758165421992e-18Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17944.0.g95(coding)
ATGAACTTTATTTTAACGTGTGAGCGATGCGGAGAGAAGTTCACTGAGGAGAGCAGAGCT
CCGGTCATTCTGCCAGATTGTGGGCACACTTTCTGCGAGTATTGTATTGCTGATTTACTC
AGTGAATTCGATAAATTCTGTCCACAGTGCAACACGGAGATTAAGACGACGGATCCGAGC
AAATACATTAAAAATCATAAAATACTGGCTCTGCTCAAAATGGATCAGCCGGAGGCGATG
GGAGACCCGGACAACTACGTGTACTGTCCGCGGCATCTGGACAAAGTCATTGAGTATTTC
TGTAAGCAGTGCTCCAATACTGTCTGTGTTAAGTGTATGTTCGATGAACATAACGGACAT
GATTTGGTATAAATCGAGGAAATGGCTAGCAGTTTGAAGCAAAATGTGCTTGATCTATAG
AAAATGCTTGTAAACGCTCACAGACTGAACGAAGAAAATTAGAAATTAATAGAGCAAGTG
AAAGAAGAGTTAAACAGACTTAAATTTCAATAAATGAAAAATATTGATAAAGGCTTTTAT
GAACTTCAAAAAAAACTGGAAGACAAGAAAACTGAGATCAAATTCGAATTTGAGAAACGA
TATAAAAAGGAGGAATAGAAATTCATGACAAAAATGTCACTTATAAACTCAAACTTGGAG
GAAATTAAAAACATTGAGAGAATATTCGAAGAATTGCTTTAATTTATAGATAATAACATC
GATAGTAAAATCTTGCAGAAGGCTAATGATGTTACTACTTTCTTGCATAAGTCTTTTACT
GATCTTGATATAATCACTAAGAACTAGATAGCTTAGAAGAGTGAAATCTATATACACCCA
AGTTTCAAACCTCTGACTCTCAATGTGAAAAAAGCCATAGAAATTGTTAACAAATTTGAG
ATGATCCCACCAAGTGGAGCAGCAGGGGCGTCCTCTGCTAAAGTCCAGAGATCTCCCTAA
GCAAAAGGTTTGATTGGCGGTGGAGGAGCAACAAACGGATACAGCAGTGGAAATGAGGGC
AGTCAAATTGGTGGCATAGAAGTGGATCCATTCACAGGTATTCCCTATTATGATCCCACT
AAGAACAGCAAAAGTGGAAATGCAAATGGTGGTGGCAGGGGCAATAATTTGCCATCAGGG
TCTTAACCTCAAAATTCAGCAGTTAGGAATAGCGGAGGCAGTGCTATGGCTCCACACAGA
CGTCCTGGTGGGGCTGGCTCTCTTGGTGAGCGTGGGGCTGGGTCATCTGGTAGTGAACAT
ATCTTCAGCAGTGTCATATGTTATGGTGACTATGAGGAGATCCTGAGATATAACCTAGAA
AGCCAGAGATGGGAGAAAGTTCGATATGAGAGCGGCAGTAGCTTGAATGGTAACTTGCGA
TATTCAGGGAGTGCCTATACACCAGACGGAAGAATAATCATTACTGGTGGATGTTTGATA
AGTACAGGGGATGCTACAAGCACTACATTTGAATGCAATATCTAGAAGCCTGGCAAGTTT
ACTAGGAAGAAGATGATGACTAATCGCAGATATGCACATGCAAGCACATCGTTAAACGGC
TACGTGTATGTTCTTGGTGGGTTCGATAACAAAGACGCTGATGGGGTGGCTCCAAGCACT
TTAGATAGCGTAGAGCGGTATTCGATTCATGAAAACAGATGGATATAGAATTGCAGTATG
AATGACAGTCGAGCATTTTGCGGTTGTGTGACTATAGGAGACTAATTTATCTATCTGGTG
GGAGGTTTCCAAGACTATACAGTGCTTAACACAATAGAAAAATATGACTCTGTGCTGGAT
AATTGGACTACACTGCTCGTGAAGTTGCCGCAAGGTCTGGCTAAGATGGGAGTGTGCGCT
ACTGATGGACAGAGATAAATGGCGATTGTTGGTGGTATGAATCCGCAGTTCCATCCTCAG
AAAGCTATGTATTTATTAGACATGAAAACCATGAAGTTTTCCTCTTGCGCAGAAATGAAA
ACAGCGAAGACTTTCAATTCGAATGTGCACTTCCATGAGGGGTCAATCTATACATTTGGT
GGTAATGACAGAGACGCCTGTGAGAAATACGATACTTATCAGAATAAATGGGAAATGCTC
CCAAGTTATGCAGAGGTCGTTAGTAGTAAAGGAACTAACGAATTAAATGGATGGACTTAG
CTTAATTGCCCCATCACACCATCACTTATTCCATTGTGA


>Contig17944.0.g95(protein)
MNFILTCERCGEKFTEESRAPVILPDCGHTFCEYCIADLLSEFDKFCPQCNTEIKTTDPS
KYIKNHKILALLKMDQPEAMGDPDNYVYCPRHLDKVIEYFCKQCSNTVCVKCMFDEHNGH
DLVQIEEMASSLKQNVLDLQKMLVNAHRLNEENQKLIEQVKEELNRLKFQQMKNIDKGFY
ELQKKLEDKKTEIKFEFEKRYKKEEQKFMTKMSLINSNLEEIKNIERIFEELLQFIDNNI
DSKILQKANDVTTFLHKSFTDLDIITKNQIAQKSEIYIHPSFKPLTLNVKKAIEIVNKFE
MIPPSGAAGASSAKVQRSPQAKGLIGGGGATNGYSSGNEGSQIGGIEVDPFTGIPYYDPT
KNSKSGNANGGGRGNNLPSGSQPQNSAVRNSGGSAMAPHRRPGGAGSLGERGAGSSGSEH
IFSSVICYGDYEEILRYNLESQRWEKVRYESGSSLNGNLRYSGSAYTPDGRIIITGGCLI
STGDATSTTFECNIQKPGKFTRKKMMTNRRYAHASTSLNGYVYVLGGFDNKDADGVAPST
LDSVERYSIHENRWIQNCSMNDSRAFCGCVTIGDQFIYLVGGFQDYTVLNTIEKYDSVLD
NWTTLLVKLPQGLAKMGVCATDGQRQMAIVGGMNPQFHPQKAMYLLDMKTMKFSSCAEMK
TAKTFNSNVHFHEGSIYTFGGNDRDACEKYDTYQNKWEMLPSYAEVVSSKGTNELNGWTQ
LNCPITPSLIPL