Identifiers and Description

Gene Model Identifier

Contig18810.0.g90

Standard Name

KELCH73

Aliases

Contig18810_0_g90

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002959600.000000000000020000882446601127Kelch motif family protein
SGDYGR238C0.00000039992052383199455KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18810.0.g90(coding)
ATGTTATAGTCTTGTGAAAATGCTTATGATACAACCACATTCAGAAACAAAGACTAGAGA
GACTCTATACTTGAAAATGGAGATTCTTCTGAGCAATTATTTTTGTGGACTCCTTGCTTG
ACAAATAACAGCGACAATTTAACACTCTCAATTAAAAGCTTAAAAGATCCTATTCAGGCA
CGAATCAATGTTTATGTGCATCATCTGAATCTCTTCAATTTTGTTTGCAGCCCTTCTGTA
TTATAACCTGAAAGCAGAACTTTTCATGGGTTAACTTAATAGGCAGATGGTACAGTTTGG
GTATTCGGAGGTATGAACAACAAAAATATAACACTAGGAGATTTTTGGAAGCTAGATACT
TAAACTATGAATTGGGAACATTTCAGTCAAACTTAGTTATTAGGTATGTCCAACTCTCCT
CAAGAAGGGTACCCAGAAGCAAGGTACGGTCATGTTATGGCTGCCTATTATGACTACCTA
ATAGTTTTTGGAGGAGCTAATTCTAAATTAGAACTAATGAATGACCTTTGGATATACTCT
ATTTAAAAAAATATTTGGGTTTAGATTCCTCATAACATAAATGAACCTAGAAGAATTGTC
CATGCAACTGCCAATTTAATTGAACCTGAAAACAAACTAATAATATTTAATGGAAAATCA
AGCAATGGTGCAATAAATGAAATATGGGAACTAGATTTAGAATTAGCGATTTAATATTCA
GAGAATCCATTGAAATAATTAAACAAGACACATATTTGGAAAGAGATATTTCCTGAAGGA
TCAACATCATAAAAGCGATTTGGACATTCAACTATTTATTTATTTCCCAATAATATATTG
ATATTTGGAGGGATTACTGAGAATTAACAAATAGCTTCAGATATACAGCTATACTCTCTT
TCTGATAATAAAATAATAAATGTCAAGAAGAAGTTTACTATAACAGGAGAGTTTCCAGAA
ATAAGAGCATTTACTTCAATGGTTCATCAAACTAATGGATACATAGCATTATATGGAGGT
TAAAATCAGTAAGGATAACTATATAAGGATTACTGGCACTTGAGATTGGATCTATCAAAT
AATTAAATCGAAGCTTAGCTTATATAAAAAGACTAAGAAGACTTAATTGAGTAAATCTTT
ATGAGCAGAGATGGCTAGAAAATTATTCAGACTGAGAGATATCAATATCCAATACTATTT
GGTTCATCAAATAAGGATTATTTCATTGACAGTTCTGACATTCTGTAGTTTAAAGATGAA
AGGTGTCAATCATAGCAAGAACTAGACTAGATGAATTGCCTTCCCTGCCCAGAAGGATCT
GTATTTTCGAGTAATTAATGTGTTTTTTGTGGAAAAGAAAGCTATTGGTTCCCAGATCTA
TCATCACCATTTGCATCAAGATGTGATTTATGCCCAGAAGGCACTGAAAAAATTCCACTT
AAGTAATATGGTTGCTCGCCATGCTAAGCTGGGACATACTATAAAAATCAATCTGCTAGG
TGCGAGCCTTGTGGACCAGATGAAATTTGCCCAGTAGCAAGCGCAAATGCATACCCACTT
GAGATGTACTAACAATTTCAAAAGACAGTGCATAAGAATGATCCTCCTTTATACTAAAAC
ACCTCCCAATTAATGGTGCAAGTAAATCATTTATTGGAGGAATAATTACTATTGCTTACT
ATATAAGTATTACAGTTCTGGTTTCAGGTGTCTTTACCCTTTGATTTATGTGAGCTTTCT
TAATCGTAGATAAATTTGACAAACTCTTATCACTATGATTAAAACAAAATGAAAATAAAG
TGCAAGTAAATTGAATATGATGAGCTTGATAAGATTCAATTCAAAAGACCAAGAGCTCAA
AGCCTAATTTATTAGATAAGAGTAATATGTGAAGACTGTGTTAAGAAAGATCCATCTAAT
TCTTTTATAGAAATTTCTCTTGGTGAATTGAGTGAGTTTGAGAAGCAAAGTTTCTATGTT
CATTTCTTCTAATGGGAGTTCAACAGCATTTGGTCCAAAGAGGTAGATGAAGAAGATAAT
TGTGAAGGGTGCTCAAAAGTTATAGGATTTACAACTCCTGAAACTCCAGATTAGCTTTAC
AATCCAAATGAGTCATTTAGAGGTGAATAACCAACAATAGTCAATGTACTGTTGACTCCA
ACATTCTACTAAAATATGGTTGATGAAATTGAACTTAGTGGTTATAGAGCTCATTTGTAA
AATATTGAGAAAGGGGAAACTATAAATCTTAGAGAGGCTCTTAAAATAGACATGAATACT
ATGAAGTAAAACATAGGTCATCCATAGGCAAACGACGTTTTTAAAATCAAATTCTAAATG
AACCTTTCATCCAACATTTATTAAATTAGAGTAATTCAATTAAAGAACATTTTAGAAGCA
TTAGCTGAAGTTATGGGATTCTTAGCTGGTTTCTCATTCTTAGCTAGGTTTTCAAAGCAT
ATTTTAGTTTCAAACAAAGTTGGAAGAGCTTATGATAGAATGATTGAAGACCATTTATAG
AAAGTGTAGCAATTAAAGAACGAACAAATGCAAGCTATTTCTTATAGCGTCTAGAGTTCC
CCAAGAAAGAATGTTCCAAATATTTAAACTTCTAAATAGTAGTCATTGCAAAGGGAAGTA
TCAACATCTCCCCTTAAATTTAGGCCTAAAGCAGCAAGCGACTATGACGCTAATTTTATG
TTTGGTTTAAGAAAAAATGATGAGGAATCACAATAGATGAAAAGAGAATCTTCTACTAAG
AAAAAGAGCAAGTTCTTAGTTATGAGTCCAGTTCATAATGATGAAAGCAGGAACAAAGCA
TCCAATCAGAGTTAGCAAGTACAAAAAGAAGAAGGATTTATGCAAGCTGACAATTAAATT
AAGCCTTACAACAAATAATTAGGCAGTTTTGGAGATGAAGAAATAGACGACGAATTCAAG
TACTTTTATGGAGATTTAAGACAAATGTGA


>Contig18810.0.g90(protein)
MLQSCENAYDTTTFRNKDQRDSILENGDSSEQLFLWTPCLTNNSDNLTLSIKSLKDPIQA
RINVYVHHLNLFNFVCSPSVLQPESRTFHGLTQQADGTVWVFGGMNNKNITLGDFWKLDT
QTMNWEHFSQTQLLGMSNSPQEGYPEARYGHVMAAYYDYLIVFGGANSKLELMNDLWIYS
IQKNIWVQIPHNINEPRRIVHATANLIEPENKLIIFNGKSSNGAINEIWELDLELAIQYS
ENPLKQLNKTHIWKEIFPEGSTSQKRFGHSTIYLFPNNILIFGGITENQQIASDIQLYSL
SDNKIINVKKKFTITGEFPEIRAFTSMVHQTNGYIALYGGQNQQGQLYKDYWHLRLDLSN
NQIEAQLIQKDQEDLIEQIFMSRDGQKIIQTERYQYPILFGSSNKDYFIDSSDILQFKDE
RCQSQQELDQMNCLPCPEGSVFSSNQCVFCGKESYWFPDLSSPFASRCDLCPEGTEKIPL
KQYGCSPCQAGTYYKNQSARCEPCGPDEICPVASANAYPLEMYQQFQKTVHKNDPPLYQN
TSQLMVQVNHLLEEQLLLLTIQVLQFWFQVSLPFDLCELSQSQINLTNSYHYDQNKMKIK
CKQIEYDELDKIQFKRPRAQSLIYQIRVICEDCVKKDPSNSFIEISLGELSEFEKQSFYV
HFFQWEFNSIWSKEVDEEDNCEGCSKVIGFTTPETPDQLYNPNESFRGEQPTIVNVLLTP
TFYQNMVDEIELSGYRAHLQNIEKGETINLREALKIDMNTMKQNIGHPQANDVFKIKFQM
NLSSNIYQIRVIQLKNILEALAEVMGFLAGFSFLARFSKHILVSNKVGRAYDRMIEDHLQ
KVQQLKNEQMQAISYSVQSSPRKNVPNIQTSKQQSLQREVSTSPLKFRPKAASDYDANFM
FGLRKNDEESQQMKRESSTKKKSKFLVMSPVHNDESRNKASNQSQQVQKEEGFMQADNQI
KPYNKQLGSFGDEEIDDEFKYFYGDLRQM