Identifiers and Description

Gene Model Identifier

Contig20663.0.g91

Standard Name

KELCH71

Aliases

Contig20663_0_g91

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003102404.999723464643358e-28Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20663.0.g91(coding)
ATGCCACCAAGAAAGTAAAAGCCGATTTACCAAGTCAAGCCAAGTTTTGCCAATGATAAT
CCTAATATCACCCCACCACCACAGTAGTAACAGTAGCCACCTCAAGCTTTGTATAATTAG
CAGTAGTAAAACCAATACTAGCCAAGGTAATAATACAGACCAAGAATGAGAAATGCACCG
CCCGAAAATAACATGATGGGAGGAGGTTTTGGGGGCATACCTCAAATGATGCCAATGATT
CCTCACATGGAAAACTTACAATAGATGGAGCAGGGTCAACTAGAGGGTCTTCTTTTATAG
CTCGTTTAAATGTGTGGTCCAGACTTTATACAGCAGATGAATAGTAATCCCATGCTTTTG
CAGTAATAAATGCAGCCATTTATGGGAGGATAGTAGATGAGAGGTCCCAACAATTAATTT
CAATATTAAAGACCCCCTCCACCTTAAATGCAAAATTAGCAGTTAGCTCAACAATACCAG
GCTATGATGCGCATGCCACCTCCAATACCCTAAGTTCAGACATAGCCCTAAGTCTAAGTC
AATTAGCAGTCTCCTCAGAATCAAACTGAAAACTAAGAGGGACAATAACCCACCTAAACT
GCATAAGTGCAACAACAATAACCTGTAGTGAGACCTTAAATGTCTGTATAAGCTCAAAAC
TAATAAGTACCATTTGGTATGCAAGGTTACAATCAAGGAGGGATGAGATAAGGCATAATT
CCAATCACCCCAATGCTTCACCCTAATTAAAGATCAAAGATTTCAAACAATCTTTGTGAG
ATTCATTTCCCTGAGCCAATTATTTTCCATTTGGATAGACCTGTCTGTAGAAAATGTATC
CCTGAATACATGAAGCAACAATAATAGAGAAGAAAAAATCCATAAGCATAGACTACATTC
AATAAGAATTAAGTCAATCAAATTGCCTAAGTGCTTGGTATAAACACAATGGCACTTAAT
GCTTACCAAAGCGAAAAGAGCATGATCAGCAGAAGCTTAGAAAAAATTCAGGAATTCAGA
AAAGACCACAGATACTATCAGATGGAGCTCAAGGAAAGAGAAGAGTAGTCAGATAAGTAT
CTTTCTTTCCTGCCAAATCAAATGAGTGAAATGTTTGATCATTTAGAGACTTTAGTGGTC
ACTCAAGAATCTTAATTCTATAACGATATTACTGAGCTTGTGAAGAAGCAGCAAGATAAC
ATCAGAAAAGATATCTAAAATAAAGTACCAGGATTTACTTAAAGACTCTCACAGAAGTAC
ATGCAACTCTAACAAGCAACATCGCTTGCTTCATCTTAAGGAGAAGACTAATAGATTCAA
GTCCTTGAATAGTACCTTAACATTTTCACAGATCTCGATGCGGAGTTTGAAAAATACTTC
AATGAATTTGAAAGTATTGGAAAATTGTAGAGACTTGTTGACAAGGATCCAAATGATATA
GTCAACGACTTTAACGAATTAGTTGAGGCCAATCTTAGAGTTGACTATAATGTCAAGAAT
AGTTTTAACAATGTAGTCATGTAAAGACTACATTCCTTCTAATGGAATCAAAGATATGCA
CAAATTTTTAAGGTTAAGACTAATTAATTTGAGAAGAGAATGGTTCAAATGGATCAAGAA
ATTCCTCTATACTCTAGATCCATAGCAATTGAGAATGGATCGATCTTCTTAATTGGAGGT
TTCATCAAGAGACAAAATACCTATCTGAAGAAGTGTTACAGATTTGATGAGATTTTTAAC
AGACTTGAAGCTAAGGCAGACATGATTTATGCACATGCTGATCACACTCTCTGTGCCATT
GAATCTTTCATTTATGTCGTAGGAACTTTTGTCAACAATCAAGTCTATGGTTACTGTGAA
AAGTATGATGTCCAAAAGAACAAGTGGAAGGCCATTGCTCCACTTAACTACCCTAGATCA
GGTGTGGCTCTGTGCAGTTTTAAGAACCAGTACTTATTTGCATTTGGTGGCAGAGTAGAC
TAGAAAAGAATCGTGGACATTATTGAAGTTTACGACATCAAGAGAAATGCTTGGTAAGAA
ATTCCAACTTCAATATGTGACAAGTCTAAATGGATCCCAGCTTACATGAGTTTGGCTTAT
CAGATTACTGACAAAGAAATTATGATTTTTGGTGGAAAGAGCGCACTTACCTTCCAGATT
TTCAACGGTGTGTTTGTCTTTGACATTGAGAAAATGGAAATTCAGGAGCGTGGTTCCCTC
GTTAACCCCTGTTCATTCATGAACACTCCTCTAGTTTTCAATCATAACTTGTATGCCTAT
GGAAATGACATCTACATTCACAAGTATTCCATCCCAGAGCAAAAGTGGACATGCATCCCT
AAAGCTCTGTTGTGA


>Contig20663.0.g91(protein)
MPPRKQKPIYQVKPSFANDNPNITPPPQQQQQPPQALYNQQQQNQYQPRQQYRPRMRNAP
PENNMMGGGFGGIPQMMPMIPHMENLQQMEQGQLEGLLLQLVQMCGPDFIQQMNSNPMLL
QQQMQPFMGGQQMRGPNNQFQYQRPPPPQMQNQQLAQQYQAMMRMPPPIPQVQTQPQVQV
NQQSPQNQTENQEGQQPTQTAQVQQQQPVVRPQMSVQAQNQQVPFGMQGYNQGGMRQGII
PITPMLHPNQRSKISNNLCEIHFPEPIIFHLDRPVCRKCIPEYMKQQQQRRKNPQAQTTF
NKNQVNQIAQVLGINTMALNAYQSEKSMISRSLEKIQEFRKDHRYYQMELKEREEQSDKY
LSFLPNQMSEMFDHLETLVVTQESQFYNDITELVKKQQDNIRKDIQNKVPGFTQRLSQKY
MQLQQATSLASSQGEDQQIQVLEQYLNIFTDLDAEFEKYFNEFESIGKLQRLVDKDPNDI
VNDFNELVEANLRVDYNVKNSFNNVVMQRLHSFQWNQRYAQIFKVKTNQFEKRMVQMDQE
IPLYSRSIAIENGSIFLIGGFIKRQNTYLKKCYRFDEIFNRLEAKADMIYAHADHTLCAI
ESFIYVVGTFVNNQVYGYCEKYDVQKNKWKAIAPLNYPRSGVALCSFKNQYLFAFGGRVD
QKRIVDIIEVYDIKRNAWQEIPTSICDKSKWIPAYMSLAYQITDKEIMIFGGKSALTFQI
FNGVFVFDIEKMEIQERGSLVNPCSFMNTPLVFNHNLYAYGNDIYIHKYSIPEQKWTCIP
KALL