Identifiers and Description

Gene Model Identifier

Contig12560.0.g82

Standard Name

KELCH7

Aliases

Contig12560_0_g82

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005024307.996885557285438e-77Kelch motif family protein
SGDYPR058W0.0000000000000299873730555305YMC1 SGDID:S000006262, Chr XVI
from 673751-674674, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12560.0.g82(coding)
ATGAATATTCAATGTTCGTTATGTTGCTAATCCTACGATAAGCAACAGCATCTCCCAAGA
ATTTTAATTTAATGCGGGCATACACTCTGTGAACTATGCTTAAGAAACATCTTAAAGACA
GATAGCGTATTCGACTGCCCTGAATGTGACACAGTAATCATAGTGGAACAAGACAAACTT
GAAAGTCAAGAATAGATCGAATAGGCGATAATGAGGTTCCCTAAGAATATCGCCTTGATT
AACATATAGGAATATGGGCAGCTGAACCTCAAAAATAATCAGTCAAAATCTGATTAAATT
AAGACTCAATAAACGTAACAAAGCAGCTCTGGATTGTAAAATACGTCAAGTAATGGTAGT
GCAATTCATTTAAGCAGAGATGATAAAAGCAAAAATACCACTAACTCAGTTGAGATTAAA
AGCTAAGACATTGATTCGGATGATGAATAATTTTAGAACTCTATCAGCAATAATGAGATA
AACTTAGAAGAAGATGATTTACTAGGGTTGCATACTTAAGAATTACTTTCAAAGAGAAAT
CCTTCTAAAAATGCTTCAGGCTCTTCTAAAATTTCAAAGGAGTAGAAACATTAAAAATCT
TAAAACTCATCGCAAAATTATCAATGCCCCACTCATCAAAAGAAAATAAAAGCTTATTGC
GCAACAGACAAATCTCTACTCTGTATCGATTGCATAGTTTTAACTGATAATCACAAAGCA
CATGAAATTATAGCCACAAATAAAGCTTACCAACAAGAATTCAAGAACTTAATTGAATAA
AATGACTAGGCACTTTTCCTGAGAGATAAATTAGTTAATATGCAGCTTGACATTGAATCT
CACGTGGATGATCTAAATTCGAAAGCTAATGACTTAAGAAAAGAAATCACTGAGATATAT
ACACGGATTAGAAAACTACTCTAAAATAGAGAGACTGAATTGAAAAAAGATATATCAAGC
AAATTAGAAAATGAATAAATAAGACTGAAACATATCACTAGAAATATCAAGCAGCAGATG
AAGCTTATTGATAAATTTCAAACTGACTATAGTAAATCTCAGAATGAAAATGAGACTGAG
TTTTTGGCAAAAGTAAATAAGAGAGAAATGAAAAGTAGAAACGCACTTTAAGAAATACAA
AATATCGATTACCCAAGAGTATTCAGTGAATTTGTGGAAAAAGATGAGCTATAAAAGATA
TCGAAGCTTATCACGTGCAGGAAAACAAATAAATAAGCTTAGTCAATTGTTGGTGGAAAC
GAAAAAGCTCCTCATATTCCATTAACACATACCGTAAACATGTCCCTTACTATGTCCTCA
AGTTTGAAAGCTTAACTAAAGTCCAATAAAAAATCTAATGCATATCAACCTTAGAAAGTG
AATAAAATCAATTTAATAACCACGAATCCACTTACCTAAACTTAATAATTGCCTTGTACT
ACACTATCGATTGCTTCATTGAGATCTAGATCCAAGGATAAGAATGAAATCTTGTTTAAA
TCTACAAATTTGATGAGAAAATCTCCATAGATTTACAACTCTAACCACTAGATGAGCCAA
TAAATGAGTTAATCTTTCTTCACATCAAATGTTTGGTAAAAAGACTAGTAGTAATCTTAG
AAGCAAAAAGGATTCTTATACGACTGCTGTTGGAATGAATCAAAGCTACTCAAATTAAAA
TAGTGCCAAGAAGAATATTTAAAAACCTCAAAAATTGATAAGTACAACCATAAATTTAAA
AGACTTGGTTTCAGATACATCCAGATAAGTCAGGTAAAAATTACACATTCAGAAAATAAC
TCTGAATTCGATGGAACTTTTGTTGATGAAGAAATCGATGAAAGTCATGTAGTAAAATAA
GAATACATAAAAAACAATCGAAATCGAGATATTCACGAATATAAATCATTCTCAACAAAC
TAAAATGTGCAGAAGTATAGTAATCATAATGCTTCTGAAAATCGATTAGATAAAATATCT
AAAAGAGATGAGCTTGGTAAATAGAAACCCTATAATGAAGATTTCTTCTCTCACAAGCAT
TAAAAGAGTCATAGTAACAGAAATCAGAATGCTTAAAGATGTTCAACAACGATTAAAAAG
GCAACTGAGTGCAATGTCTAAGAATTAAATCATTATAGCATTAATCCTACACCAAAGCAG
CTTAATTTTAGCGAATGGGAAAACCTGAAAATTCTCTAGTGCAACTTAGATGTAACAGGC
AATGACAGTTCTTAAATGATTACTAATTCGATGATTTAAAATGACAATTATAATTCCTTG
AAATATGGACAAGAACACTAAAATCAATATGATTTACTTAATTAGCTTTATCATAAAACT
GAACCTTTTCTCTACTCTATTTCAGGGTATTAAGAGTCTCCATTAAATAGCATTGAAAAA
TACGATCTCTAAAGAGGTATTTGGACTGAAATATAAGGAGCTATGACAATACCTAGAACC
AAATTTTAAAGTGTAGTCTGTTAAAACTTAGATTAACAGAATGAGCCATTAGTGTATATT
TTGGGAGGCAAACAGTTTAATGGTCAAAGGACTGATACAATTGAAGTTTTTAATCCAAGA
ACTGGTGATGTCAAATTAATTTAGCAACGATTACCTAAGCCAAGGTCTGGCTTTGCTGCA
GTATGTGTAGGAAACTAAATTTTAATGATAGGAGGCAATGATGGAAATGTTCTCAACAAA
GTCGATGCCTTTGATTTGGATACTAAGGAATGGAAGAAATTGCCTAGCCTTAATTAAGCG
AGAGATGAATTAGCAGTTGCTTTAGGTCCAGATATGAAGATTTATGCAGTCGGAGGATAC
GGTTATCCAGATAATAATTGCTTAAACTCAGCTGAGAGATTTGACCCTGCAATAGGCAAA
TGGGAAATTTTACCTCCTATGAATGAATGCAGACGCTCACTAACTTTAGTAGCTTTACCT
GATGGAATATATGCAATAGGAGGATATAATGGAAAGAATTACTTATCTTCAGTTGAAAAA
TATGATGAATCAAGGAAAGAATGGGTTATAGTAAGCTCCATGAATAATGAACGTTGTACA
TTATCCGCTGTCCCAAGTCCAGATTTTCAATATATCTATGTTTTGGGTGGTTTCAACGGG
AAACCCTTAAACGTAGTAGAGCGCTACTCTATCTTAAATGACGTTTGGGAATTCGTTACT
CCAATGAAAAGAGCTAGATTCATGCATTCTTGCTGCTTTGCCAATGTCGCCAGTCAATTT
AACATGAATCAAAACTCAATTAGCAGTCCCTCTAGTTTCCTTTTTGGTGCTACGAATACC
GTAGTGGGTCATCCTTTCGATACTATCAAAACTAAGATGCAGGTGCATAATCAGTATCTC
AGCAGCAGAGAAGGCTACATTGAGAGTGTCAAGTCTGTGTATAGACATGAAGGAGCGATT
GGGTTTTATAGAGGATGTGTCCCTCCATTCTTTGGCTCTATAATCTATAGGTCACTTCAG
TTTTCCGTATTTGAACTGTTTTATACCATGTGGGAGAAATCAAGTATAATGACAAGTTAA
ATTCCATTAACAGGAGGTTTGTAACCGAGAGTTATATTTTCAGGCATGTTATCTGCTGCA
GCTAGGTCAATAGTGGAGTGCCCATTTGAGTATGCAAAAGTAAAGGGATAGACTGGCTAG
TCATGGGAGTTCAGACATGCTTATCAAGGTTTTGGAGTCTTGTTGCTAAGAACAACTGGT
TTAATGACAACCTACTTTATTTTAATTGACACTATTCGTAGAAAAACAAACGCCTTCTAA
TCTAAAATGGGATAATTTTTGGCATCTGGAGGTTCAGCCATGTTCGGCTTCTGGGTGGTC
TGGCCCTTCGAATAAATTAAAAATCAAATTTAAGCTTAAAAATTAGATACACATGAAAGC
ATTATGTCAAGGGCTCGTTCAATTGTAAAAGCAGATGGAGTAGTAGGTCTATATAGAGGT
ATCATTCCAGGCAGTTAAAGTGTGTTCTTAAGAAATGGAGCAGCTATGATTGTAATGCAA
AAAGCTTAGAAATTTTTAACAGAAAAAGGGTATAGGGACTGA


>Contig12560.0.g82(protein)
MNIQCSLCCQSYDKQQHLPRILIQCGHTLCELCLRNILKTDSVFDCPECDTVIIVEQDKL
ESQEQIEQAIMRFPKNIALINIQEYGQLNLKNNQSKSDQIKTQQTQQSSSGLQNTSSNGS
AIHLSRDDKSKNTTNSVEIKSQDIDSDDEQFQNSISNNEINLEEDDLLGLHTQELLSKRN
PSKNASGSSKISKEQKHQKSQNSSQNYQCPTHQKKIKAYCATDKSLLCIDCIVLTDNHKA
HEIIATNKAYQQEFKNLIEQNDQALFLRDKLVNMQLDIESHVDDLNSKANDLRKEITEIY
TRIRKLLQNRETELKKDISSKLENEQIRLKHITRNIKQQMKLIDKFQTDYSKSQNENETE
FLAKVNKREMKSRNALQEIQNIDYPRVFSEFVEKDELQKISKLITCRKTNKQAQSIVGGN
EKAPHIPLTHTVNMSLTMSSSLKAQLKSNKKSNAYQPQKVNKINLITTNPLTQTQQLPCT
TLSIASLRSRSKDKNEILFKSTNLMRKSPQIYNSNHQMSQQMSQSFFTSNVWQKDQQQSQ
KQKGFLYDCCWNESKLLKLKQCQEEYLKTSKIDKYNHKFKRLGFRYIQISQVKITHSENN
SEFDGTFVDEEIDESHVVKQEYIKNNRNRDIHEYKSFSTNQNVQKYSNHNASENRLDKIS
KRDELGKQKPYNEDFFSHKHQKSHSNRNQNAQRCSTTIKKATECNVQELNHYSINPTPKQ
LNFSEWENLKILQCNLDVTGNDSSQMITNSMIQNDNYNSLKYGQEHQNQYDLLNQLYHKT
EPFLYSISGYQESPLNSIEKYDLQRGIWTEIQGAMTIPRTKFQSVVCQNLDQQNEPLVYI
LGGKQFNGQRTDTIEVFNPRTGDVKLIQQRLPKPRSGFAAVCVGNQILMIGGNDGNVLNK
VDAFDLDTKEWKKLPSLNQARDELAVALGPDMKIYAVGGYGYPDNNCLNSAERFDPAIGK
WEILPPMNECRRSLTLVALPDGIYAIGGYNGKNYLSSVEKYDESRKEWVIVSSMNNERCT
LSAVPSPDFQYIYVLGGFNGKPLNVVERYSILNDVWEFVTPMKRARFMHSCCFANVASQF
NMNQNSISSPSSFLFGATNTVVGHPFDTIKTKMQVHNQYLSSREGYIESVKSVYRHEGAI
GFYRGCVPPFFGSIIYRSLQFSVFELFYTMWEKSSIMTSQIPLTGGLQPRVIFSGMLSAA
ARSIVECPFEYAKVKGQTGQSWEFRHAYQGFGVLLLRTTGLMTTYFILIDTIRRKTNAFQ
SKMGQFLASGGSAMFGFWVVWPFEQIKNQIQAQKLDTHESIMSRARSIVKADGVVGLYRG
IIPGSQSVFLRNGAAMIVMQKAQKFLTEKGYRD