Identifiers and Description

Gene Model Identifier

Contig8679.0.g63

Standard Name

KELCH69

Aliases

Contig8679_0_g63

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011085105.000201715856339e-35hypothetical protein
SGDYPL263C9.997764199084386e-16KEL3 SGDID:S000006184, Chr XVI
from 46506-44551, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8679.0.g63(coding)
ATGATAACTTTAGTATGGAAAAAAGAAGATGTTTGCCAAAGCGCAAGCTATCCAACATCC
AGAGAAGGCCACAGTTTTACTTATATCTCAACTTTGTAACAATATTTTCTATTTGGTGGA
ATATCAAGCAAAAGACACAATGAACTTTTCTTTTATGATTCAAAAACAAATGGATGGAAT
TTGATTGATTCTAAAGGCAAGGGGCCCTTAGCCAGATGTTATCACGTAGCTTGGTATGAT
GAGCCACATTTCTTCATTCATGGAGGTAAACAGTCGGATAAGGGTTAATTGAGTGATGTG
TACTGCTACAATATCGAAAGTATGAGCTGGAAAAAATTCTTTTCTATGGAAAGTCCCCTA
CCCAGATCTTAACACGCTGCAATAGTAGCAAATTCAGGAATTGGGTTAGTTTTCGGTGGA
TATTGTGCTTCAAAAAATCTTCTACTTAATGATATGTGGACTTTCGATTACAATTCTGTT
CCATTTTCAACTTAAAAATCAAATGAACTGCCTGGAGGAATCTGGACCAAACATCCTTAA
ACAGGAAATGTACCTAATGGCAGAAGAGGACACACTCTTACAAAGATACCTAATCAATAA
AAAGCTATTTTATATGGAGGTTTTACTCATCTTAGCAACTCAGCTGGTCAAGTTCAAGAC
AACTAATTTTATATTCTAGACATTAAAACATTTTCCTGGAGTATTCTAAACTTGATGGGT
TAATATCCAGAACCAAGAGGATTACATGTACTGTAATTCTTCAAAGACACTCAACTTATA
ATATTTGGTGGAATCTCTACTGACGATTGTCAAGGTGAATAAAGGCCTAAAGTTTTTGAT
GATTTCCATATGCTTGACTTAAAAGACAACTTTTTCTCAGCTCCATTTACAGCAAATATC
AGACCTTCAGCAAGATATGGCCATGCTTGTGACTCAAATTTAAAAACATTCTTAGATAAA
AAGGGCATGAGCCAAACTTAGAGCTTACAAATTGGGGAGTTTGAACCCATGCACGAACTT
ATTATTCTAGGAGGGCTTGATTCTTAATATTGTACTATGGATCCATTTATTTTGTAAGAT
AAAATTATCACTGAACATACTAAGTGGGAACTCACTTAAGTATCAAAAGTTAAATCAGAT
AATGCTAATAATCTTGAATCATCAGTTAAACTAGCCAACAAAAATATCATGGAGAATCGT
AAGATAATAGCTAAACTAGAAAGAAATCTAAGCGACATGTCCGAGGAGTTAGCCTCCTTA
AAGTATAAAAAGCGTCAAATGGAGGATGAACTGGACCTAAAAATAAAATCCTACAAAGAA
GCAGTGAAACAATTCAAAGACCAAGACCGCAGACTGATTAGTGATAAGCAGAGACACGAG
GATCGAATAATTGCCATGTAAAACCTCATTGAGTTGGAGTAGAAAATGCAGGCTGTGATT
GTCAGGAAAATTGATGTCATAGAAAGAAACTTCGCAAAGAGTGAGTAGTTCATCATTACA
CTGGATACTTTCTTGAACACAGCTAAAACTAAGTTGAATCATAATTCAGGTTATGGATTA
CCCTAAAGTGCATTACCTGGTGAAGTGGATTTGGCTTTCTTAGATAGTTAAAAGAACCAA
CATAAGCAAAACTTGAAGCAAATAATGCATTACTACTAAAACTTCGAATAAAACCACAAA
GAAATAACAAATAAGTTGGAATTATAGAGGGAGGATCAAGGTTAATTCGAGAATGAAATG
CGCTAATTGCATGAGATATAAGTTGTTTCCAAGAGCGATTTAGTTGATAAATTGAAGAGT
ATAGATTGA


>Contig8679.0.g63(protein)
MITLVWKKEDVCQSASYPTSREGHSFTYISTLQQYFLFGGISSKRHNELFFYDSKTNGWN
LIDSKGKGPLARCYHVAWYDEPHFFIHGGKQSDKGQLSDVYCYNIESMSWKKFFSMESPL
PRSQHAAIVANSGIGLVFGGYCASKNLLLNDMWTFDYNSVPFSTQKSNELPGGIWTKHPQ
TGNVPNGRRGHTLTKIPNQQKAILYGGFTHLSNSAGQVQDNQFYILDIKTFSWSILNLMG
QYPEPRGLHVLQFFKDTQLIIFGGISTDDCQGEQRPKVFDDFHMLDLKDNFFSAPFTANI
RPSARYGHACDSNLKTFLDKKGMSQTQSLQIGEFEPMHELIILGGLDSQYCTMDPFILQD
KIITEHTKWELTQVSKVKSDNANNLESSVKLANKNIMENRKIIAKLERNLSDMSEELASL
KYKKRQMEDELDLKIKSYKEAVKQFKDQDRRLISDKQRHEDRIIAMQNLIELEQKMQAVI
VRKIDVIERNFAKSEQFIITLDTFLNTAKTKLNHNSGYGLPQSALPGEVDLAFLDSQKNQ
HKQNLKQIMHYYQNFEQNHKEITNKLELQREDQGQFENEMRQLHEIQVVSKSDLVDKLKS
ID