Identifiers and Description

Gene Model Identifier

Contig11336.0.g8

Standard Name

KELCH67

Aliases

Contig11336_0_g8

Description

Regulator of chromosome condensation (RCC1) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00415 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam13540 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam03740 ) Pyridoxal phosphate biosynthesis protein PdxJ
  • ( pfam07646 ) Kelch motif
  • ( pfam07569 ) TUP1-like enhancer of split
  • ( pfam13953 ) PapC C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005866309.996907204735647e-62regulator of chromosome conden
sation (RCC1)
SGDYGL097W0.000000030002053728821195SRM1 SGDID:S000003065, Chr VII
from 321782-323230, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11336.0.g8(coding)
ATGCTCCCAGTGAAAGTTAAATTAAAAGAACAAGTACTGAGTGTAAGCACATTTTCAAAT
GGATCTCTATGTTGCACTACAATCGGGAAGGTATATGGTTGGGGAATCAATCAAAAAGAG
AGAATTGGTATTCAAACTAGTCAATTACAGAACCCATCTCCAGTTCATATTGCTATACCT
CACTAAATTGTCAAGGTTTCATGTGGGTAATATCACTCACTCATACTAACAAACGCAGGA
CAAGTTCTGGGAGTCGGCTAAAATAAAAACGGAGAGATCGGTATAGATAAGCCAAAACAA
GTTTCTTAATTTACACTTGTGCCATTTCCTTCACAAGAAGTTCGAATATTAGAAATTGAG
GCTGGTTTTGCAGTGTCACTTTTCATCGATGATTAAAGATAACTTTGGTCAACAGGTAAG
AAAAGTCTCAATGCTTAGAAAACAGAGGTTAACACTCCAACGCTCATAAAGATGTTTGGA
AAGCATCAATCTTAAGAAAATTAAGTTAATGAGGAAGAAAAAGTAACCTGTTAAAATTCT
AAAAATTGTGGAGTATAAATGATAAACTGCGGATATAATCATGTGGGATGTGTGACTATG
GATGGAAGCTTGTATATGTGGGGAAACAATTAAAATTCCAAACTAGGTATAGGATCAAAG
AAAGAATATATTGAAAAACCAACAAAAGTACAGTATTTCCAAGATCAAAATTTGAAAGTG
AGTTAAATTTCTTGTTCTATGGGGGAGAGACATGGACATACTGGATGTGTAACTTCCGAG
GGAAGAGTGTTTATGTGGGGAGACCCATACAAAGGAAAGCTTGGAAATTTGAAAACTGGT
TGGACTCATGAAAAAGAAGATAATAAAGATGTAGAACTACCATTTGAGCTTGATCAATCC
TATATAGGTCCAGCTAAAAAGGTAGTATGTTCAGGCATTCACTCTGCTATTGTAAGTTAA
GATGGAAAGCTATTTACATTTGGATGTGGTTCAGATGGGAGATTGGGACATCCAGAATAT
GAAGGATATGTATATTTGTACAAAGAAAGTGCACCAAAGTTGGTTCAAGCTTTTGAGGGA
AATGTAGTATCAGATTATGTAGCTAGTTATTATTAGAATTATGCGATTGTAATCTCTCAA
TGA


>Contig11336.0.g8(protein)
MLPVKVKLKEQVLSVSTFSNGSLCCTTIGKVYGWGINQKERIGIQTSQLQNPSPVHIAIP
HQIVKVSCGQYHSLILTNAGQVLGVGQNKNGEIGIDKPKQVSQFTLVPFPSQEVRILEIE
AGFAVSLFIDDQRQLWSTGKKSLNAQKTEVNTPTLIKMFGKHQSQENQVNEEEKVTCQNS
KNCGVQMINCGYNHVGCVTMDGSLYMWGNNQNSKLGIGSKKEYIEKPTKVQYFQDQNLKV
SQISCSMGERHGHTGCVTSEGRVFMWGDPYKGKLGNLKTGWTHEKEDNKDVELPFELDQS
YIGPAKKVVCSGIHSAIVSQDGKLFTFGCGSDGRLGHPEYEGYVYLYKESAPKLVQAFEG
NVVSDYVASYYQNYAIVISQ