Identifiers and Description

Gene Model Identifier

Contig3100.0.g75

Standard Name

KELCH66

Aliases

Contig3100_0_g75

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004730105.997739233660418e-28Kelch motif family protein
SGDYPL263C0.000000000000001999258566166494KEL3 SGDID:S000006184, Chr XVI
from 46506-44551, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3100.0.g75(coding)
ATGCTAAATGATGTCTTTGTCTTTGACATTGAAGAATCAACTTGGAATAATTTAGAATTC
TCCAATGAAGATCTAAATTTAAATCATCCCAAACCTAGATCTTCTCATGCTGTTGCTTTA
GATTCAGATTTCAAAGATAGATTTTATATGTTTGGAGGTACTGGAATTAACTTAGGATAA
AGCAATTTCAGTGACTTATGGGTCTTTGACTTTAGATCATAGAAATTTCGAGAAATTTCT
TAAAGCAAAATAAACAAACCTCATGGAATGTATGGACACACTTTAAATTATTATAAGAAT
TCTCTTTATTTATTTGGAGGTACCAATGGATTTGAATATTATAATGATCTTTTGAGATTT
GATCTTCTGTATTTCTAATGGTAAAAAGTAGTTACAGTCAAAGGAAGTATTGATCCTGAG
CCTCGTTATAAACATAGTGCAGTTATGATTAGTGATGAGAACAAGCTTATAATTTTAGGA
GGAACTAACTAAAACAAGAGATTTGGAAATATCTATGAATTTAGCTTTGACAAAAAAGCT
TGGTCTTTAGTCAACATTAACAAAAATAAGTAAATTTTCAAGGGTAGATACGGTCATAGT
ACGGATTTAGTGTCATCTGACTTAAAAACTTAACAAAATCACATAATAATATTTGGAGGA
CTAGAAGATAGACAAAAGAATGACTTGATTAGATTTGATTTAAATTCAGGAAACTTCAAT
TTAGTACAATTAAATGACATTGAGAATATTCCATCTGAGAGAGACTTTCATTCTTCAGTC
TTATTTGAGAATTAGCTATATATAATAGGATGTGGGAAGACTAAATGA


>Contig3100.0.g75(protein)
MLNDVFVFDIEESTWNNLEFSNEDLNLNHPKPRSSHAVALDSDFKDRFYMFGGTGINLGQ
SNFSDLWVFDFRSQKFREISQSKINKPHGMYGHTLNYYKNSLYLFGGTNGFEYYNDLLRF
DLLYFQWQKVVTVKGSIDPEPRYKHSAVMISDENKLIILGGTNQNKRFGNIYEFSFDKKA
WSLVNINKNKQIFKGRYGHSTDLVSSDLKTQQNHIIIFGGLEDRQKNDLIRFDLNSGNFN
LVQLNDIENIPSERDFHSSVLFENQLYIIGCGKTK