Identifiers and Description

Gene Model Identifier

Contig14225.0.g56

Standard Name

KELCH64

Aliases

Contig14225_0_g56

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14225.0.g56(coding)
ATGAGACTATCGCATAAGATTGCTTTTCAATCACCAACTCTCGCTCTCATATTAGAGTAT
TTGTTGTAAGTAGAGAGAGTCTAAATGCAGCAACTCTGCACAACCTTTTATCATAAAACG
ATACCTCAGAAACTGACACCTTAAACAACAAGTTTCTTAAAATATGATCCAAACTATACT
ATTCAATACTTGGGAGAAAAACGACTTTTCAGAATCAAAATATCTCCCTAGAAATTGACA
CCGGGTTAAACATACATCGATAGAGTATACTGGCTGCCAGTAAATAAATTATGGGATGTT
CAAGTTGAAAGTAATTTTCTGAATTGGAACTATGAACTTATCAAGAATCCTCAGAAATTG
AAAATTGATAAGGTCTTCAGAGTAGAAGATTCATTTTATTTATATGAGAGAAATGAAAAT
GAGACAATAATTCACAAATTAAATTTGTTCACATTTGTTATTACAAAAATAGCAACCCTT
AAGATTCCATATTACTTTGGTGCAGGTTTTGGGGTTATCTAGGGTCGATATATAATGCAA
GCAGGAGGCTATCTTTATAAATAAGTTTAGCAGATGTTTGGAAACAGAGTGCATAATACA
AGGACCGAGTATACCTTTGAATACAATCTAGAATTTCAAGTTTTCGATTGCTTTTCTGGT
AAATTCTTAAACTCAAAAAGATTCGGCAAATTGAATAAGGGAAGACATGGATGCGGAATA
ATTGAAAGAAAAAATAAAGTTTATATTATTGGAGGGGTCTAGTACTCAAGTAAATAGAAA
AAAGTGTTTAGTAGTTATAGGGTGGAAGTTTTAAATTTTAAAAATCCAACTGGACTACAA
CTAAAGGAAGTGGAAATGTTTAAATTTTGCCCTCCTAACATTGTAACGTTTTGCGCTTGC
TTTAATGATGACTATGTGTTTATGACTGGATATTAGATAAATAAAGAAAACGGCCTTCCA
AAATACCATGACAAGCCTGAGATAAATTTATCAGAAGAATATACATTCTAATTGCATATT
AAAGATGATGAAAATAACTTCAAAAATAATTCGAAATATTAATTAAGTTAAGGAAAATAA
TAGCAACCATTATTGAGCATTCGAAAGTATCCCAAATTAAATGAATTAAAGTTTGAATAT
GTATCTAAACAAGTTACTAAAGAGGTAGAACACATGAAATCAAGTTCGAACTATTAAGAT
ATTCTAGTAGCAGGAAAATAAGTAATAGCAACTAATTACTTAGGACACATAAATGTCTCT
TACTAACCATAAATTGAAGATGTTTAGAACGATAAGATTAAGTTCTATTACATTCCAGCA
AGTAATGTAATTAAGAATTTGAACCCAGCAATATTTTAAAAACCTTCATTTACATTATAT
GATAAAAAACCTGCTGATTCAAAATTAAAATCTAAAGAAAAAAGTATCGTTGAGGAGATT
AAAGAATAAAATCATTCAAAATTAAAGGGAAATTAATAGAAACATGATAAAATGTAGAGT
GTTAATCTTAAAAATGAATTTAAGTCAAATCTGATTCAAAAGTAAATTATTCAAAGCGAA
AGATTAAATAGTAGTGTTAATCAATCCCACTAGGATCAAGGGTAGATTCATAATTAAATT
GCAATCATTCAAAGCGAGTAATAAAACAGAATAACTAGTAAAATTAACTCAAGTGTTTTA
ACGAGTAGATAGCAAATTTCAAGGCCAGCAACTGCAACAGTAAACATAATTAATAAACTT
TAATCTACAGCTTAAAATTTAATTGCTATTAGGGATTCTAATATTGTCAGTAGTAATAGA
CCTTAAACTGCTACTATCAAGCCAAGCAAGTAGTCTATGATAAAGGAACAGCAAAAATAA
GATTGA


>Contig14225.0.g56(protein)
MRLSHKIAFQSPTLALILEYLLQVERVQMQQLCTTFYHKTIPQKLTPQTTSFLKYDPNYT
IQYLGEKRLFRIKISPQKLTPGQTYIDRVYWLPVNKLWDVQVESNFLNWNYELIKNPQKL
KIDKVFRVEDSFYLYERNENETIIHKLNLFTFVITKIATLKIPYYFGAGFGVIQGRYIMQ
AGGYLYKQVQQMFGNRVHNTRTEYTFEYNLEFQVFDCFSGKFLNSKRFGKLNKGRHGCGI
IERKNKVYIIGGVQYSSKQKKVFSSYRVEVLNFKNPTGLQLKEVEMFKFCPPNIVTFCAC
FNDDYVFMTGYQINKENGLPKYHDKPEINLSEEYTFQLHIKDDENNFKNNSKYQLSQGKQ
QQPLLSIRKYPKLNELKFEYVSKQVTKEVEHMKSSSNYQDILVAGKQVIATNYLGHINVS
YQPQIEDVQNDKIKFYYIPASNVIKNLNPAIFQKPSFTLYDKKPADSKLKSKEKSIVEEI
KEQNHSKLKGNQQKHDKMQSVNLKNEFKSNLIQKQIIQSERLNSSVNQSHQDQGQIHNQI
AIIQSEQQNRITSKINSSVLTSRQQISRPATATVNIINKLQSTAQNLIAIRDSNIVSSNR
PQTATIKPSKQSMIKEQQKQD