Identifiers and Description

Gene Model Identifier

Contig18892.0.g32

Standard Name

KELCH62

Aliases

Contig18892_0_g32

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18892.0.g32(coding)
ATGGAAATGCGTTTCAAGAAATCAACCATGTCCGCTGCTTCGATTCCATAAACACAATCA
AATAGAGGGAGACAATCAATTACAAACATAGTCAGCACGAGTTAAATATTAGGCTAAACA
GCTATTTCATAATAAAACATGAATCATAAGTAAAAAAGCTCAGGTGATAATAACTCAGCC
AATTAGTCCCAGAGATCACATCATGCGCAGGAATAATTTAGAGAATTGGAGAAAATCATA
TCAAAATCACAGATTGGGTCTCTGGTATAGTTGCCAACAAAATCTAATGAAAACAGTTAC
TTAGTTAATGAAAGTAATTAGCAATTGAAAGAATTCTTAGCAAATAATTAATAGTATAAC
TCCCAGGGATACCAGCAACCACCAAATTATGATTAAGAATTCAACGATTAGCAAGATGAA
GATGAGTAAATTAGATTGATGATATTGTAGCAGTCATAAAATTATCCAGGGCAGTCCCCT
TTCAATCCCAAGTAGCAGAAAACTAAATTTGAAGTGTAAAACGTCGATTTGTCTACTTAT
AATGGATCTTACGATTTAAGAATGAATGACTCTGATAGTTAACTTTTAAAGAGTGAGGAG
TTGCAGAAAATGAAAAATGACAGCCTGAGAATGTAATCTAATTTCAGAGTTTAATAGTAG
AAAGAATTGAGTGAATACATGGATGGGGCAGACGAAGAAGAGTTTCCATAGGATGACACA
GAGTTTAATCAAGATGATACTATAAACCAAGAATAAAAACACCAGAATAACAATGCTAGT
AAATTCTAAGATTTAATTAAGCAAAAAGAACAGGCTAAACTAAGAGAAGAACAAAAGTAG
AAATATCAACGAGTCTCAACTTTAAAAACCGTGCAAAAACAGAGACTAAATCCAAATGAT
TAAATTGATATCAGGAATCGTAGGCTGAGCTAACTAGTTCAAATCAAAGGGCATGTTTTT
GAAAGTGACGATAGCTTGGAGCTAGACTAAGGAGCTTCTCCAAGTGCTAAATTAATGAAT
TAGCCCAGTGGCATAGTTAAAGGCAAAATCATAATTAAGAAAAAGTTTGAAATTGACTAG
ATTTAAGAAGATTTTGATGCTGAGCAGGATGACTATAGTTCTAGAAAGCAGACACTTCCT
AGTCAAATTTAAAATTAATATGACAAAAATGATTCTATGTTGGAGAATAACGAGGAATTT
GAGGATTTAGATAACCAAATAAGAAAGAGTCTGGTTTAATTGCAAATAGATGAAGTTATC
AAACCTCTTGGAAATTAAGATAGAAAGAGGGGCAGGAATGTTTATATTTCACCCACAAAA
GAAGATGAACTTTATGATTAAATGCACGCAATTAGAAAATCTGATGATCCAAAATCGCAT
TTATTGCCTTCAAATATAGAATATATTGATTAATTTCAAAAAAGCGTTAAGCCAGATAAG
TCTCCTAGGATAAATAATGATAGAGATACAATAAAAGAAGTAATAAATTAAAAAAAATAA
CAACAAGTAGAGTAATAGCTAAAATATATGCAAGAAGAAGAATAGAAGGAAGAAACTCAA
AATAAGAAAAGAAGGAAACGTTCAAGCTAGGAAAGAAAAAGTTAAGAACGTAGTAGTTCT
GAAAGATCTGCTAGAACTTAATAATAAGAATAGCAATTACTTGCTGAAACTCAAAACTTA
AAGAAGAAATATCAGCCTACAAATGACGTGATTATAGAGTAATCTAATGAAGACACAAAG
ATACTCAGTTAATTAGATAAAGATCATTCTAAGGAAGAAAGCGGCATGAAAAACATTCAA
TCAAGTATGATTAGCATGCGGAAGTCATATCAAGAGATAGCTCTTAAAATCATAGACGAA
GACCAGCCTGCATAAACTTAGCAGCAAAATGCGTTGATTCCAAAGAAAGATAAGTTGAAA
CATCTAAATAAACCACACAAGGAAGATCAAGACTATCAAGAATAAAGTATGGATGTATCT
GTAGCTGATTATACAATGATTGGAGGCAAGAAGAAGAAAAAGAAAAAGAAGAAAAAGAAG
AAGAAGGGAGCAAACAATGAGACCATAGTCAGTGAAACTGATATCACAACAATGAAAGAC
AGTGAGATTGAGAGATAGCCATTAATAAGCACAACAAGAAGTAAAGGCAATTAATTGAAT
AATAATTTGAATAAGCCAGCTGACCTTGATAAGAATTTCGATGATAATGAGTTAAGAGAA
GATAATCACTAGGAAGAGTTAAAAGATGATAAACATGAATAATCTTTTCCAGATAGTCCC
CAAAAAACAGGAGATAAATTTGCACAAAAGTAATTGCCACATGTAGAGCCACTTGCCGAT
AAATCTAGAATTAGTCCTTAGAGTTTTAAGAAGAGATTTTCAATTGACAAAGGATATGAA
CCTATCAAGTTCAATTTACAGGCTTCCACAGATAATTAAGGCAAATTTGTAAGATAAAAC
TCACAGAACCCTGTAAGCTAGGTGAAATTACCATATCTTAATACTGAGACTGAAGCATAG
AGTGCAAACGATCAAATGTAACTAAACTTTGACAATAAGTCTAAGTAATCTAATCAAAAC
AAGTTACTCCCTAACAGCCCATCCTTTACCTCTGACTAGGGTAGTATTAATAATTTTAAG
TATAATCGGAATTAGAATCAGAACAACAACTTATTTCTAGCAGCTTCTGCTGGTTAACTC
CCACCTCTGGATAGTAAAAGAAGACTATCAATGCAATCGAGTGATTTAAGTTTACATGAC
TCTGCGACTTACCGATAACATCAATACGATAACAACAATCGTGATGATGCACATAATAAT
TACTTTACTGAGGGGTAGTCTTCCTACAGACAAGTAAAGCAAGTAAGACATGACAGAGGC
AACACTAATGTATAAAAAATCTAGAATATAAATCTGAATAGAGCATCACTTAATAATCAG
TCGATACTTTAATAAGTCTGCGAATTGCATCCAAATGAGAAAATCAAGTATTTCTGTAGA
GACGATCGAGTTGGACTTTGTCCAGAGTGTGTGGTTCATCATGCTAAGCATGATTTTGTC
TTGGCAGATGAAGGGGCTGCATTTGAAGTAAAGTAGCAATTAAAAACTCTAAACATAAGT
GTTTCTAGTAAACTCAACGAATATTCACTGGTGTAAAAAGAATCAGAGTCAAAGTTAAAA
GAAATGGAAAAAATGAAGGAGGAGGAATTCCAAAAAGTCAAGTATTTTTTCAATGAACTT
CATAGAATGCTTGATTAAAGAGAGGATACCATAAAAAGACAATATACTGAAGCAATTAAA
GATTGCGAGTCATTTTTAACTTAAGATTGCCAAAAACTAACTCACATCTATGCATAACTG
GATTAGATTTAACATTAAATTGATAAATTAACGAAGAGTTTTGAGAGAGCAACTGATGGA
GCTATAGTAGGTGGCAGTGACCGAATAAAAAGCATTGCGAAAAGTTATTAAAACTTTAGC
AAAAAGCTGTTTCATAAACACCCACCTAAATCCTTCACTGTGAGAACAAGGGATATCCCT
ACAATACCAGTTTTCAACATAAATTTATCACATACCAAGAGATTCATTGAAGGCTTAGGC
ACACTATAGCAACCCACTCTATTTAAAGAGCTGGGATTACTTAATGAACCACCGACCAAC
ATGTACATGCCTCAACAATAAAATTAATTCCAGACTCAACAATACTCAAACAGATAGGGT
AATGAATAATCCATGCAATATTATGGGAATAATGAAAAAGTATAGCAAGCTTACTAATTG
ACAAAAGGTCAACAATTACAATTGATGTATCAGTAAATGCCTACTATTGATAATGTTTAT
TGGTAAAAGTGGGATACTTATGATGTATTCAAATATGATTTCTTCAACAGTCAATGGACA
AACATACCTCACATAAAGCCCCAGTCCAAGTTTCTCTTCTTCTCTTCGGTATCTCATCTT
CCTAAATCCTTAGGAATGTTTATATTAGGAGGGAGTGACTCAGATGATAACTTTTCTAAG
CGTACTTTACTTTTTAGTAGATATCAGAAATTTGTTGAAAAACCTCCTATGATATTTAAA
AGAGCCTTCTTTCCTTCGTTATTTTGCCTCTCTGATTCTTGTTTATATGTGTTTGGAGGG
CATGATGGAGTTTCTGATTTGAATTAATGCGAGAGATATTCAATTGCTGAAAATGTTTGG
AGATAAATAACTCCAATGACTACGCAAAGAAATGGTTCAAGTGTAGTATCTTTTGATAAA
GTTATTTTTGCTTTTGGTGGAAATAATTCTCTATAAGGCTCTATGGATACCATTGAAAGG
TATGCTGTTGAATTTGATAAATGGACTCTTATAAGTTTGAAATTAAATGAACCACTGCAC
GATACAATTGCTTTTAATATAGGTGGAGGCAGAGTACTGATATTTGGAGGATCAGTAGAT
GATCAACCAAATACTAAATTCAACATCTACGATTTGACCAGTGAATGTATTGATTAAAAT
GAAACTAACTTTTCAGGCGGTAAAATATATTTGCCACCTGTGTTTGATATGGGCTCAGGA
AATCTGCACATTTTTCAAGGCTATGGTGACACAAATCTAACTCATAATAAACTGCTAGCT
GGAGATATGTTTTGCAAGTGTCGAAATAGTGACTGCCAATTCTAATATCAGTGGGCTTTT
GAAAGCCAATAAAAATCTCAGTTAAGAAAAACTTAAATTATCGAGTCATAAAAGTTAAAG
AAAGAGCAGTCAACAAGATTACCTACGAACAAGTTAGAATAATTTTCTGTCACTGGCTAA
CAACAACAATAATTCAAGCTAGTTTAACAATAAAAGCAAATAAAATTCATCAACATCCTT
AAATAAAAGTAAACCATATCATGA


>Contig18892.0.g32(protein)
MEMRFKKSTMSAASIPQTQSNRGRQSITNIVSTSQILGQTAISQQNMNHKQKSSGDNNSA
NQSQRSHHAQEQFRELEKIISKSQIGSLVQLPTKSNENSYLVNESNQQLKEFLANNQQYN
SQGYQQPPNYDQEFNDQQDEDEQIRLMILQQSQNYPGQSPFNPKQQKTKFEVQNVDLSTY
NGSYDLRMNDSDSQLLKSEELQKMKNDSLRMQSNFRVQQQKELSEYMDGADEEEFPQDDT
EFNQDDTINQEQKHQNNNASKFQDLIKQKEQAKLREEQKQKYQRVSTLKTVQKQRLNPND
QIDIRNRRLSQLVQIKGHVFESDDSLELDQGASPSAKLMNQPSGIVKGKIIIKKKFEIDQ
IQEDFDAEQDDYSSRKQTLPSQIQNQYDKNDSMLENNEEFEDLDNQIRKSLVQLQIDEVI
KPLGNQDRKRGRNVYISPTKEDELYDQMHAIRKSDDPKSHLLPSNIEYIDQFQKSVKPDK
SPRINNDRDTIKEVINQKKQQQVEQQLKYMQEEEQKEETQNKKRRKRSSQERKSQERSSS
ERSARTQQQEQQLLAETQNLKKKYQPTNDVIIEQSNEDTKILSQLDKDHSKEESGMKNIQ
SSMISMRKSYQEIALKIIDEDQPAQTQQQNALIPKKDKLKHLNKPHKEDQDYQEQSMDVS
VADYTMIGGKKKKKKKKKKKKKGANNETIVSETDITTMKDSEIERQPLISTTRSKGNQLN
NNLNKPADLDKNFDDNELREDNHQEELKDDKHEQSFPDSPQKTGDKFAQKQLPHVEPLAD
KSRISPQSFKKRFSIDKGYEPIKFNLQASTDNQGKFVRQNSQNPVSQVKLPYLNTETEAQ
SANDQMQLNFDNKSKQSNQNKLLPNSPSFTSDQGSINNFKYNRNQNQNNNLFLAASAGQL
PPLDSKRRLSMQSSDLSLHDSATYRQHQYDNNNRDDAHNNYFTEGQSSYRQVKQVRHDRG
NTNVQKIQNINLNRASLNNQSILQQVCELHPNEKIKYFCRDDRVGLCPECVVHHAKHDFV
LADEGAAFEVKQQLKTLNISVSSKLNEYSLVQKESESKLKEMEKMKEEEFQKVKYFFNEL
HRMLDQREDTIKRQYTEAIKDCESFLTQDCQKLTHIYAQLDQIQHQIDKLTKSFERATDG
AIVGGSDRIKSIAKSYQNFSKKLFHKHPPKSFTVRTRDIPTIPVFNINLSHTKRFIEGLG
TLQQPTLFKELGLLNEPPTNMYMPQQQNQFQTQQYSNRQGNEQSMQYYGNNEKVQQAYQL
TKGQQLQLMYQQMPTIDNVYWQKWDTYDVFKYDFFNSQWTNIPHIKPQSKFLFFSSVSHL
PKSLGMFILGGSDSDDNFSKRTLLFSRYQKFVEKPPMIFKRAFFPSLFCLSDSCLYVFGG
HDGVSDLNQCERYSIAENVWRQITPMTTQRNGSSVVSFDKVIFAFGGNNSLQGSMDTIER
YAVEFDKWTLISLKLNEPLHDTIAFNIGGGRVLIFGGSVDDQPNTKFNIYDLTSECIDQN
ETNFSGGKIYLPPVFDMGSGNLHIFQGYGDTNLTHNKLLAGDMFCKCRNSDCQFQYQWAF
ESQQKSQLRKTQIIESQKLKKEQSTRLPTNKLEQFSVTGQQQQQFKLVQQQKQIKFINIL
KQKQTIS