Identifiers and Description

Gene Model Identifier

Contig20089.0.g115

Standard Name

KELCH6

Aliases

Contig20089_0_g115

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069709.99648502569394e-38Kelch motif family protein
SGDYGR238C0.000019995566179747357KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20089.0.g115(coding)
ATGGATATAACCTGCCCAATCTGCTTTGATCAATATAATGATAAAGATAAAATTCCTCGT
ATTTTATAATGTGGTCACACATTTTGCCAGAATTGTTTGATGGACTTGAGAACTTCTAAT
ATTTTAACTTGCCCTACTTGCAGGAAGTATTTTGCACCAGATGTCAAGCAGCTTATTAAA
AACTTCACAATACTAGACTATATGTGCCAACATAAAGATTAATTGGATCAGAGCTATCTT
GCGGATGAATCTTAAATTGAAAAGTACTGCTTAAAGCACCCTTAAAAGAAGACCAAGTAT
TTCTGCGAGACTGACCAGCTAAATGTGTGCTCTAAGTGCATAGTTTCAGACCACTAAGCT
CATAGAATCAGTGAGAAAGGGGAAACTTAAGTTCCACATAACTTCACCAAGAAATCTCAA
ATTCTTATAAAAAAGATTGACGCTTCACAAAGTGAGACTTTAATGTTTGAGGAAGAGTTA
AATGAGATATAAGAGCAACTTAAGAACACAAAGGAAAATACTTTACAAGAACTAGATGAG
AAGTTAGAACTGCTTATTGAGATGCTTAAAAATCGTAAACACACATTGGCAAAAGCTGTT
AAGCATCATTATAAGAAACAGGAGATTTTCTTGATGGAAGCTTAGAAGAACATTGAGAGA
AGAAAGAACAATTTGACAAAGCTCAATGGAAAAGTTTAATCTTTGGTTAAAGTTGGAGCT
CAGAATGAAAGCAAGCTGGAAAGATTGGAAGAAGAATTCGTTTAATTCAACAGATCCTAT
GATTCCCCATTCCATCAATTTAAACATTGCACAGTAGGGCTTAACCCTTAATTTGTAAAT
CAGATGTTTGAAGGTATAGGAAATTTGAAATATCCAATTGTACAATTTTCAAATAGAAAT
ACCTACAAGTTTTTCAACAACAAATTCAAGACTGTAACAAAGAGTCTTTTCTTTGGGGAT
TCAAATAATCAAGATCTGATTCTTTAATATGATTACTATAAAGATTCTTGGGGTAAGAGG
GAAGTTCCTACTAATTTAGTCCTACAAAGTTACTCAGTAGCAATTGGTTTGAATGACGGT
TGCATTTTAATTACTGGAGGCCTCAATTCTTCTTTCACGAATGTGTCAGGTTCTGTCTTT
TTATACAATACTGAAAACGAGAGCTGCACAGAAAAGGCAACTTTGATACAATCAAGATAC
ACACATTCTTTGGCTCATTAATCAAACTTCGTGTATGCCTTGGGTGGTAGGTCTATAAAC
GGTGTTCTTGATGCTTGTGAAAGATATTCAATAAATCTCAATAGATGGGAGAAAATTGCC
AAACTAAACTAAAAGAGATGCACCTCCCCAGCAGTCGTATTCGAGGATTCTTATATCTAT
GTTTTCGGGGGTTATGAAGGTAGCGGTCGTATAGATTCAATAGAGCAGTATGATGTAACT
AATGATCACTGGACAGTTTTGCCTGTTAAGTTCCCTCTCTCAGTTGAAGCTGAAACAGCG
ACATTAATCTCTCAAAATGAAGTCGTCATTCTAGGAGGGCACGATAATAGCGCTGGAACA
AAGGACGCAATGATTCTAAATTTAGAAACTCTGTAGTTTATAAAGCTTGCTCCAATGCCC
TATGCTAGATTCTTGCATAATGCTACTTTCTTTAACAATCACATTTATGTATTTGGAGGT
GTGGACAACTGCTCATGCCAAAAAATGAATTGTATTGATTTCTAATGGACACCTGTTTCA
AGTTACAAGGAAATTATCAATTATAATCTTCAAACCTTCTCTTCAGCCTGCGTTTGA


>Contig20089.0.g115(protein)
MDITCPICFDQYNDKDKIPRILQCGHTFCQNCLMDLRTSNILTCPTCRKYFAPDVKQLIK
NFTILDYMCQHKDQLDQSYLADESQIEKYCLKHPQKKTKYFCETDQLNVCSKCIVSDHQA
HRISEKGETQVPHNFTKKSQILIKKIDASQSETLMFEEELNEIQEQLKNTKENTLQELDE
KLELLIEMLKNRKHTLAKAVKHHYKKQEIFLMEAQKNIERRKNNLTKLNGKVQSLVKVGA
QNESKLERLEEEFVQFNRSYDSPFHQFKHCTVGLNPQFVNQMFEGIGNLKYPIVQFSNRN
TYKFFNNKFKTVTKSLFFGDSNNQDLILQYDYYKDSWGKREVPTNLVLQSYSVAIGLNDG
CILITGGLNSSFTNVSGSVFLYNTENESCTEKATLIQSRYTHSLAHQSNFVYALGGRSIN
GVLDACERYSINLNRWEKIAKLNQKRCTSPAVVFEDSYIYVFGGYEGSGRIDSIEQYDVT
NDHWTVLPVKFPLSVEAETATLISQNEVVILGGHDNSAGTKDAMILNLETLQFIKLAPMP
YARFLHNATFFNNHIYVFGGVDNCSCQKMNCIDFQWTPVSSYKEIINYNLQTFSSACV