Identifiers and Description

Gene Model Identifier

Contig10059.0.0.g16

Standard Name

KELCH56

Aliases

Contig10059_0_0_g16

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004836200.000000000000020000882446601127Kelch motif family protein
SGDYHR158C0.0000029996948234116693KEL1 SGDID:S000001201, Chr VII
I from 417179-413685, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10059.0.0.g16(coding)
ATGCCAAAATACCCTCCATTTCTAGATGACTGTCCATAAATAGATTTTGATATAGTTCAA
AATTCTCCAGATTCAATTTCATCCCCCATCAGACATCCATAATGGGGTCTTCTGGCTCGA
AGAGTGATGTCTCCATTTAAGGAATTCATAAAATATGCTAAAAGACACAATAATATTCCC
GATATAGATCCAAATTTTTAATAAAGTGAAGAGATAGCGAAAGACTCGAGCATAAGAATA
AAAAATACTAGCAAATTATATAAGCAATCAAAGAAAATAAAAGATTTTAACAGCAAGAAT
AAGCAAAATAAAGCTGCTCAAAATTAGCAATAAAGTAAACCTAATGGTGCAAGTGTCTCA
TTTTAAATCGATGAGAAGATAAATAAATCAGGGTCTAGAGTAAGTTCAATGTATCATAGC
AAAAATGAAAGCTAGATTAGAGATCAAATACAAAATGCGAGAAAATTTAATGAGAAATAA
ATGATAAATTTAAATCCTCTCAAATCATCCAGTTAAAATGGAGATTCACGCAGTAGCTAA
AATGTGCTTCCCGTTGTAGATGAAGTTGAGAATGATTTTTAGAATTAGAGAATTAATATT
CATGAAGACTCTGTTAAGGCGAGTCATCACTTAAACCAAAATAGCTAAAGTTTGATGAAA
AGAGTTGAATAAGCAGTCAGGAACCGAGTATTAGCTTCCATTGAAAAATTCAAGTAAATG
CAAAGTCCAAAAAGAGATATAGAAAACATCAATTAAGATCTGAATTTCGAGAACTAACTT
TAAAAGCAATTTAATCTCAAAAGTTTCATAAATAACTTTGAGTCAATGAGATCAGAAAAT
TTAAACCTAAAGCCAAATCAATTCAACAAAACTACATCCAATTTTTCAATAAATAGAGGA
AGATTAAATTAATTAAAAGCACACCATTATTCAACTTCTCCAATTCCAAAAACAAATTTA
AAAAGAAAGAAAAAATAAAAGAACCAAAGCAAAACTATTTATTAAACTTTTAGCAATGTT
GAAATATCCAAAGAAAACAATGGCATTGATATTGACGTATTTAGAGACTATGCATAGCAA
ACTTTAAACTCAAACCTCAAGATAAATAAGTCCTTTGATAACACCTAGAAGAACAAAAAA
TCAAAATTTTACTTAAATAATAACCCTTTAAACAACACTTAAAATTCTTTCTATGGATTT
AATTCGAATACTTCAATATCCAAACTGAAGTCTCTATACAATTTGAAAAACGATAAACTG
CTCTCACATCTAAAATAAACTTCAAAAGCTGAGAAATTGCAAATTTACAATAATTTCACA
AACTCATAATTAAATACTCTTCTAATGCAAAAAAGAAACAATTTACAGCTTCAAGATAAA
ATCTCAAAGTAGAATATTCCAGGTAGAGGTGGAGCCTCGATGACTCTTATCAATGATAGC
AAGGAACAAGCAACTTTGCTTATCGCATGTGGTGCTTCTAGGGATCAACAATTTAGTGAT
TTCTGGACTGTAACTATTGATAAGGAAACTTTATAACCAACCTCAGCTTAATAATTGAAG
GTTATTGAGCGAGATGGCTTCACAGGAAGAAATTCAATGACAAGTGTCTATCATCCCGAG
AAGAATAGAGTTGTATATTTTGGAGGCTAAGATTCAGAAGCAGGCGTCCTGTATAATGAC
TTATTTACACTTGATTTAAATAACCTGACATTAACACATCATGATTACTTAGATGGCCAA
GTAACTCCTGCTCCTCGTAATTCTCATACTATGACTTTGAGCTCAGATGGGAAATCAGTT
TTTGTTTTTGGAGGTGCCAACCAAGATGGACCACTAAGAGACTTGTATAAGTTAGACTTA
GAAACCTTAGTGTTTAAATAGATTAAGCTAAATGACTAGGACCAACCCTTGCCATTTATT
GAGATGCATACAGCCGAGCTTTACAATAAGGATTTCCTATTAATACTTGGGGGGCGTGGG
ATCTTTTCTGGCTAATCTTTAGATCAAGCAGCATTTCAAAATACTATGTATCTCATTAAC
GTCTCTGATGATGTTAATGAACAAGGAATTGTGTCAAAGCTTGGAGATCTACCTTCAGAT
TTGAGTTGTCACGTATCTTCTCTTATAAACGATGAACACATTGTCACATATGGAGGTACA
AATGGCTTGAGATTTTTCGATTCAGTCACACGATATAGTATCTCTTAAAAGAAGTGGACT
CTTATGACTGGCATCCCAGAAAACTGTAAGAAATCCAGATTTTTCCAAGATGGCAGAATA
TCACCATCTCAAGTAGCAGTTAAAGATGAGTTTTTAGTAATTTTTGGAGGCAGCAGCATT
GAAAAAGAGTGCAATGATTTCTTAATAGTTCCTTTTGCTCATATTTCAAAAGATGAGAAT
TTCAATGAAATCAATGAAATTATGTGA


>Contig10059.0.0.g16(protein)
MPKYPPFLDDCPQIDFDIVQNSPDSISSPIRHPQWGLLARRVMSPFKEFIKYAKRHNNIP
DIDPNFQQSEEIAKDSSIRIKNTSKLYKQSKKIKDFNSKNKQNKAAQNQQQSKPNGASVS
FQIDEKINKSGSRVSSMYHSKNESQIRDQIQNARKFNEKQMINLNPLKSSSQNGDSRSSQ
NVLPVVDEVENDFQNQRINIHEDSVKASHHLNQNSQSLMKRVEQAVRNRVLASIEKFKQM
QSPKRDIENINQDLNFENQLQKQFNLKSFINNFESMRSENLNLKPNQFNKTTSNFSINRG
RLNQLKAHHYSTSPIPKTNLKRKKKQKNQSKTIYQTFSNVEISKENNGIDIDVFRDYAQQ
TLNSNLKINKSFDNTQKNKKSKFYLNNNPLNNTQNSFYGFNSNTSISKLKSLYNLKNDKL
LSHLKQTSKAEKLQIYNNFTNSQLNTLLMQKRNNLQLQDKISKQNIPGRGGASMTLINDS
KEQATLLIACGASRDQQFSDFWTVTIDKETLQPTSAQQLKVIERDGFTGRNSMTSVYHPE
KNRVVYFGGQDSEAGVLYNDLFTLDLNNLTLTHHDYLDGQVTPAPRNSHTMTLSSDGKSV
FVFGGANQDGPLRDLYKLDLETLVFKQIKLNDQDQPLPFIEMHTAELYNKDFLLILGGRG
IFSGQSLDQAAFQNTMYLINVSDDVNEQGIVSKLGDLPSDLSCHVSSLINDEHIVTYGGT
NGLRFFDSVTRYSISQKKWTLMTGIPENCKKSRFFQDGRISPSQVAVKDEFLVIFGGSSI
EKECNDFLIVPFAHISKDENFNEINEIM