Identifiers and Description

Gene Model Identifier

Contig417.0.g67

Standard Name

KELCH54

Aliases

Contig417_0_g67

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069700.000000000000001999258566166494Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig417.0.g67(coding)
ATGATTGAACTGCAAAATGTGACAGCCTGCCCAAATGATAATGAAATAATTGTTGAGAAG
TTTGCTGATGAGTGCAGGAAAAATTAGAAAATACTTAATTTTGTTAACTCTGAAGATGCA
GTTCCGTTGCTTTTTGGTAAATTCGATAGCATTTCATGCCCTAAACATCCAAATAAATTG
ATTGAATATTTCTGCAAAACATGCAGTAACTCAGTTTGTGTTAAATGCATCTATGATGAT
CACAATGGTCATATGCTCATGCAAATTGAAGAAATGTCTAACTCTTTGAAATAAAATGTC
ATTGACTTGAGAAAAATGATTGATAACACAAGGCGTTTAATCGAAGAAAATTCAAAGTTA
ATAGAATAAGTTAAAGAGGAACTAGAAAGGCTCATGGAATAGTAGTTGAATAATATTCAA
GAAGGATTCAATGAGTTATAGAGAAAGCTTGAAGAGAAAAAACATGAGATTATTTTTGAA
TTTGAAAAAAAATATAAGAAAGAGGAACAGAGATTCTTAAGCAAGTAAAACTTGGTACAT
TCAAACGCTGATGAACTGGACAACATAGAAAAGATCTTTGATGAACTAGTGCAATTTATC
GAGATCTCAAACGATGCCTAAATTTTGCAGAAAATTTCAGATGTAACAACTTTCTTGCAC
AAATCTTTCACTGATTTGGATATTATAACAAAGAATTAAGTAACTCAGAAAGGAGAAATT
TACATTAACAATAATTTCAAGCCACTCTCGTTGAATGTGAGAAAGGCCATGGAAATTGTA
AAAAAGTTTGAAATGGTTTGGCCTTCCATAGATCAGAGAAAATAGATAAAATTGTTTGGA
ATGATGGACACAGATAATAAACTAGGATTGTATGGACCGCCAGGAGGAGGGAGATTAGGT
TCAGCAAATGGAATGTAGAGACTGGGATCTAGAGGTAGTTTCAGTTAAGGAGAAGACTCA
TTTTTCTAAGCTAATAATAACGATGAAAATTAAAATGGTAACAAAAAACCACCTCTAACA
TCAACTAATAAATCTCAAAGCACCTTGCTTCCTAAATCTTTAATGAACGCCTAACCTGGT
GGAAATGGTAAAAGTGCTAAACTGCCCCCAGTACAGAACCCAAAAACTAGAAATTTAAAA
ACTGCTGGGGCTAGTAATAGTCAGGTGAGAATTAGAACAAATTAGGCAAGCAATAGTATC
AACGATTAAGATTCGATTCCAACTTAAAGAATAGGTGGTGGCTTCAACCAGAAATCAGCT
TTTGCAAGTAATTCTATGAACAGTAATAACTTAGGATCTCCGGATAAAGAAAGAGTTAAA
TTCAATGTCGCCAATCAATCATTAGTAGAGAGTAATTCAAACAAGCAGGAAGATTAAATG
TAATCTTAAGAGTTTTCAGTTGGTTCTATGCAATGGTGGGTTTAAAACTTTGATAATAGC
TCCACATATGATGGTACTCTGAAATATATGAGTGCATGTGCTACTGTAGATAAAAAGCTT
TACCTTTCTGGAGGATGTTTTACAACTAATGCATATCCAAGTTCATTATGCTTTGAAATA
AGCACAAAATCTATAACAAGACCTGTAAAAAAGAAAAACATGCTTCTGAAGAGATACGGC
CACTGTACTATCTTTCTTAATGGATTTATGTACGCGATTGGAGGATTCAGCCATAAAGAT
ATACCGAATGAGATACCTGTGACTTTAGCATCTTGTGAGAAATTTTCAGTCTTAGAAAAT
GTATGGTCTTATGTGAGCACAATGAATGAGTCTAGATCTTTCGCTTCAGTTGTCGCCTTA
GAGAACCAATTCATCTACGTTTTTGGAGGATTACATGATTTCAATGTGTTGCAAACAATA
GAAAAATACGATACTATCAATGATTCTTGGGTCTCATTGTAATTTAAATTACCTGTTCCC
TTAGCAAAGTTAGGAGCTTGTGTTATAGACAATCGGAGTGTACTGATTTGTGGTGGTATG
TCAGCAGATTTCGAGCCTTAAAAATCCACATATTAATTTGATTTGTAAAGCATAAAATGG
ACTAAGAAAGCCAACATGATACATCCCAAGTTGGTCTCTAGTGGATTGTTTTATTCTAAT
GGATATGCATTTGCAATAGGTGGCAATAACGAAGGGGAGTGCGAAAGATACAATATTGAA
AAGGATTTGTGGCAAAGAATTCCGTCATTTGCTGGCAAAATTAATGGAGAGAATTCTCTT
TATACTTATACTTGCTGTATGATAAAATGA


>Contig417.0.g67(protein)
MIELQNVTACPNDNEIIVEKFADECRKNQKILNFVNSEDAVPLLFGKFDSISCPKHPNKL
IEYFCKTCSNSVCVKCIYDDHNGHMLMQIEEMSNSLKQNVIDLRKMIDNTRRLIEENSKL
IEQVKEELERLMEQQLNNIQEGFNELQRKLEEKKHEIIFEFEKKYKKEEQRFLSKQNLVH
SNADELDNIEKIFDELVQFIEISNDAQILQKISDVTTFLHKSFTDLDIITKNQVTQKGEI
YINNNFKPLSLNVRKAMEIVKKFEMVWPSIDQRKQIKLFGMMDTDNKLGLYGPPGGGRLG
SANGMQRLGSRGSFSQGEDSFFQANNNDENQNGNKKPPLTSTNKSQSTLLPKSLMNAQPG
GNGKSAKLPPVQNPKTRNLKTAGASNSQVRIRTNQASNSINDQDSIPTQRIGGGFNQKSA
FASNSMNSNNLGSPDKERVKFNVANQSLVESNSNKQEDQMQSQEFSVGSMQWWVQNFDNS
STYDGTLKYMSACATVDKKLYLSGGCFTTNAYPSSLCFEISTKSITRPVKKKNMLLKRYG
HCTIFLNGFMYAIGGFSHKDIPNEIPVTLASCEKFSVLENVWSYVSTMNESRSFASVVAL
ENQFIYVFGGLHDFNVLQTIEKYDTINDSWVSLQFKLPVPLAKLGACVIDNRSVLICGGM
SADFEPQKSTYQFDLQSIKWTKKANMIHPKLVSSGLFYSNGYAFAIGGNNEGECERYNIE
KDLWQRIPSFAGKINGENSLYTYTCCMIK