Identifiers and Description

Gene Model Identifier

Contig22714.0.g75

Standard Name

KELCH52

Aliases

Contig22714_0_g75

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000377609.997975313387782e-28Kelch motif family protein
SGDYGR238C2.999758165421992e-18KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22714.0.g75(coding)
ATGGAGATACTAAAGAAGTGGGAAAAGATAGATGTGAGAGGTGATAATTACTCACCAAGA
ACAGGACACACAATAGTTGAAAATAATGGAGATTTTTATTTATTTGGAGGTGCTGATTCA
GATACAAGGACAAATGACTTATTTATATTCTCTCTTGAAAAGAAAAAATGGTTTAAGTTG
AATCCTAAGGGACGATCAATGCCGACATCAAGATCAGGAGCTCAAAGTTTATCCTACTAA
GCAAGCATCTATATCTTTGGAGGATATACCAGAAAAGGAGGAGAGTACTTCAGCGATATC
TACGAATATAAGTCAATAGAAGATGAATGGTAATAAATCACTTTATTTTATTAAACTAAT
GAAGGGTAGATCTCTGAAAATAAGTGGTCATGCATTTCAAACAATCCCTTTTAATTGTCC
TAATCTGACAAGTAAAACCTGATTAGCTTGCATTTTGTAGAGTCAGAACCAAAACTAAGA
TTTGGTCATTCAGCTGTAGTTTATCAAAACTACCTTTATGTTTTTGGTGGATGGGATGGA
AATGTGACGCTCTCTGACTTGACAATATTCGATCTGAATCTCAATTTATGGGTTTAGCCA
GCTAATATTAAAGGTGCTGTTAAGGGAAGGTACAGGCATACAGCTATTTCGACTGACACG
TCAATGTATATATTTGGAGGCATAGACCAGCAATAAGAGAGATTTAATGATATTCAAGAG
TATTTCTATGAAACTCAATCTTGGACTAGGGTTGTCACAATTGGGAATTCCCCAAGCGCT
AGAACTTTTCATCAAAGCATCAATTTTTAAGGGTATTTGTATGTTATCGGAGGATTTGAT
GGTATGAAGAGAAATGACATGTATCGCATTTATCTTGGAGGCACAAAGTAAATTGCATAA
AATAATAATAACAGTCATCTTGATCAATTATACAACGATTACTAGAAGAAAGATAAAATT
TAAGCCTAAATCTTTACTGATGATTACTTTAATAACATGAAAGTTGGAGAATGGTTGAAA
ATAAAGCCTTAAGGTTGCTTCATCACCCCTCGTACAGGAGATATTCCAATGCCTAGATCT
GGAGCAAGGGGTGTAGGCTTTCGAGATTGTTTGTATTTCTTTGGAGGATATTAGAAAAAG
AGTGGTGAATATTACAATGATCTCTTTTACTATGACTTAAATCGCAAAAGATGGGATCGC
TAGATTGACATGGAAGGGGAGATACCCTCTGAACGTACAGATCACACAGCTTGCCTTTAT
GATGGACAGCTATATATATTTGGAGGGTGGAAGAAAATAAGTGGAGATGGGACACTTCCA
CTTAATAGATTTGGACACACTGCAGTTGTATATGAACATAGTATGTTTATATTTGGTGGT
TGGAATGGTCATGATACACTTGATGATATCTATCAATATAGTTTTGCTTCTAATTTCTGG
TATGAATTAAAAAGAGCAAAAGGCCCAAAACCTAAACCTAGATATCGCCACACTGCTGTA
ATGTGTGGAGGATCAATGATTGTTTTTGGAGGTGTAGATACTGATCAATAACGTTTCAAT
GATTTATTCATTTATGAAATTGAAAAACGTAGATGGTCAGCAATTCAAACAACTGGCTAG
CAGCCACAACCCAGAACCTTTCATAAAACCATAATTTTCAACAACATAATGTATGTCATT
GGAGGATTTGATGGACAAAGACTTAATGATCTGCATTAAATAGCACTGCCTTAAAACTTA
TATGAAGAAGATTATGACTAAATGCGTAGAATATCTAGACCAGCCTCTTCTGCTAGTGGT
ATTATGTAAACTGTTCCATCTGACTTGCCCATTTATTAACTGGAAGAAGATTTCAAGCAA
AAAGATTATAAGTATCTGAATAAAAAAGTAGCATTACTCAAGCGTTAAGTATAAGAACTC
AGTGGTTTACTCAAAGCAGAACAAGAAAATGGAGATGACTGCAAGATCTGCTATTCAAGA
GATATAGACACTGTATTTCTAGAGTGTGCGCATAGAGTAGCATGTTCCAAATGCGCGAGC
AATAGTACTATCAAGAAATGCCCTTATTGCAGACATGAAATTCATAGAATAGTTAAAACT
TTTAATGTTTGA


>Contig22714.0.g75(protein)
MEILKKWEKIDVRGDNYSPRTGHTIVENNGDFYLFGGADSDTRTNDLFIFSLEKKKWFKL
NPKGRSMPTSRSGAQSLSYQASIYIFGGYTRKGGEYFSDIYEYKSIEDEWQQITLFYQTN
EGQISENKWSCISNNPFQLSQSDKQNLISLHFVESEPKLRFGHSAVVYQNYLYVFGGWDG
NVTLSDLTIFDLNLNLWVQPANIKGAVKGRYRHTAISTDTSMYIFGGIDQQQERFNDIQE
YFYETQSWTRVVTIGNSPSARTFHQSINFQGYLYVIGGFDGMKRNDMYRIYLGGTKQIAQ
NNNNSHLDQLYNDYQKKDKIQAQIFTDDYFNNMKVGEWLKIKPQGCFITPRTGDIPMPRS
GARGVGFRDCLYFFGGYQKKSGEYYNDLFYYDLNRKRWDRQIDMEGEIPSERTDHTACLY
DGQLYIFGGWKKISGDGTLPLNRFGHTAVVYEHSMFIFGGWNGHDTLDDIYQYSFASNFW
YELKRAKGPKPKPRYRHTAVMCGGSMIVFGGVDTDQQRFNDLFIYEIEKRRWSAIQTTGQ
QPQPRTFHKTIIFNNIMYVIGGFDGQRLNDLHQIALPQNLYEEDYDQMRRISRPASSASG
IMQTVPSDLPIYQLEEDFKQKDYKYLNKKVALLKRQVQELSGLLKAEQENGDDCKICYSR
DIDTVFLECAHRVACSKCASNSTIKKCPYCRHEIHRIVKTFNV