Identifiers and Description

Gene Model Identifier

Contig19788.0.g51

Standard Name

KELCH49

Aliases

Contig19788_0_g51

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004199300.000000019990673443141236Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19788.0.g51(coding)
ATGATTCCAAAACACACAAGAACAAGCTCTGGACTACAAATAAAGCCTAAATAATAAAAA
CAAGACCCTATCCTCAGTCAAAGAAAAAGAGTGTTTTGTGGGGAACACTTAGAAGAGGTT
GTACATATTTAATAAAATTCAGCACATCAAGTGACCAGATAATATTGCAAGGAATGCTTG
TAAATTGATCACACAACTTTTAATATAGATGAGGGTGGTCAGCAATCAACTCAATAACTA
GAGAGCATATTTCACAGGAATTTAGAGATGAGTTAATAGCTCCTAATTTAAAGCAATCTA
GCCATCAAATAGTATGCTAGTGTTTATAGTAAAGCTTCCAGACTTTTAAATTAATCAGTT
AAGGATGTTATTTAAGAGGCAAAACATTCTGTAATATCAATGTTAGAAGACTATTTCGAT
CAAAATAATTGCCAGAATATCAAAGATAGAATGTATTCAGAGAAGCTTAAACAATTAGAT
GATCTGAAGAATCAATATCAAACTATTGTTAAAAATTTAACCAATATTAACGAGCAAGCT
CTTCTTAACTACCGGCATCTCCAAGAAGATTTGTGTTGGCACATCTCAACCCTATTAAAC
TAATCTCCTGTTAAGAGATAAGAATAACTTTTGTAAAATATGTCTTACTCTGACGACGAG
ACAGAGCATGCCAAAAAGCTAGTCAATAATCTTAACACTTATAATCAATTAGGATCAAGA
GGTGGGTAGTTCAAATCAAATCATTCAAACTTCAACATAATGGATTCTTTCAGAGCAAAT
TAATCCATTGAATACTCAGAGCATAACAACTCTCTTTTACAGGGCAGTGAAGGTGGAGCA
GGTACTTTCGAAAACTTAATCTACAAGCAAAGTTAAAGCATCTAAAGTTTGGAATAGGGC
AATAATGAAGAAAGTGAAGAGGACTCTTTGGCTGAAGAGACAAACTTTCAAAAAGAGGCT
TTCACTCATTATTTAGATGAATAGTTAGAGAAAATACATAAAATGCAAAATAAGCAGTAC
ACTAATGGTTTGAGTAACAATCAACAAGATTTTAATGTCGCCATGCATAACAATGAAATT
TAAAGATTGAAGGATGTTGTAGAAAGAGAAGAGGAAAATTGTAAATAAAGATTGCTAAAG
CTTAAAAAACAAAAAGAGGAGGAAGATGAGAAATTTAAAACAGTTACAAATGTTAGGTAT
TAACTACAGAACATGTTAAAGAAGGATTTGTACTTCATTAAGGGTGAGAGCTCGGAGATA
TTTATATATGATTTGAATTCATCGAAATTCAAAGTTTAGAAGTTTGAAAATTTTACTTCA
AAGTTCCCGAAAAATTTCTCTTCTGTTCAGATGCTTAATAGAGATATTTTCTTATTTGGT
GGTGTGTATCAACAGAGTAAGTACTCATAAAAGACATTATAAATTAAGCTTAGTTCAACA
AAGTACAAATAGTAAATATGCGAGAAATCTCAAATGATTTCACCTAAGATAAACATTCCA
ATCTGCCTTATTAAAAATAGATATGCTTACTTATGTGGAGGTTTCTATAATAAAATGCTA
ACTGATTGTGATATTTACTCTATCGAAGAGGATAGGTGGTTTGAAGGTCCGAAGCTAAAC
TACCCGAGAGCTAATTGTGCACTATGTCCTTTTGATGACAGGTTTATCTACATATTTTGT
GATGCTGGTTTGCATGGTTCATCAAATTTAATGAAAAGTATCGATGAAGACTTAAGCCTC
TCCCTCGACTACAAATGGGAGGTAATTGAGGTGAAAGATTAAAAAGAATTCATTGCAAAT
ATTCACTTTAATGGTGTCATTCAAATTTCACCTAAAGACATCCTTATCTTTGGTGGCTAA
AATCGTCAGTCTTTTAGATTTGAGATCGACAGTAAAAAGAACAAGGAATCTATGATTAAA
ATGGATAGTAAGTTTAATGTGAGGCAAATGAGCAAGTTCGTTTATGAGAAAGATTTCTAG
GCAATTGTTCAGCAAAACTAACTGTTTGCAATAGACCCTAATTACAAAACTGTACACATA
CTTGAAATAAACAAGCTGCTCGAGGAATCTCAAAACATAGATAAATATTTGCCAAAACCC
GGATAGACAGAAGAGGACAAGGTAGTAGGAGTGGGTGAGGAGAATAAAAAATAACCCACT
ATGTGGATGTCCAATTTAAGACTCAAATAGATGCATTAGTTAAGTCCTGGCCCTTCCAAG
TCAAAGATGATGCCATCGAAGAAAGTCTTAGTAAAGAAAAGCTTCTAAGAATTTTCACAA
GCTGCTGCAACAATAAACTTGAACAACAGTTCTCATACAGAAGCAAACAATACACTATGG
GAAATTAAAACATTCAAAGAAATTGGTATAAATATAGCAAATGTAGTATATTTCACTTTA
AATAAAATGTCTTTCAAATATAATAACTTCATGGGGGGTCTTGGACTAACCACTTAACAG
GAGTAATATGAATCCAGAACCAGTGGGAACAATCAACTTATACCCTATGCATCGAATAAT
TCAGCATCTAATAAGCAATTCAATCAGCCGTTGTTTAATATAAAGGAAGGTAGAGCTTCA
TCAAGAGGATCTCATTAAAACTTCAAGTAGTAAGATAGCTTATTTGGCTAGAATAAATAA
CATAACGGAGCTATGACAGTAGGAAATGCACTTATGAATTTCAGGAATCAACGAGGTAGA
TCAATTCAATCAGCTGGCAAGCCGCCTATAGGTAGTTACCCAGGTCAACTACCGACTCTT
GGTTTAAACAGATACAAGAACGTCGATATTAAAAACGGAGAAAACTCTAAGAATCCATTC
AGCATTTAAAGCCAAACGGAGAAACTGCTGATTGCAAGAGAACGAGAAAGAGAGAATAGA
GATATGAATCGTATGCACAGTGACGGCTTAAGAGTCTTTCAAAAAACCATATAGAACAGG
TAAAACAGAGCAGGTGTTATTCGAGAAATCAATGATATCAAACCAACTAAGAATGGAAAA
ACTGATTAATTAATGTTAATGAATGCCTCGTATGAAGATCAGCAACAAATTCAGCAGTAG
AATAAAAAGCTTAACATTTTTGATGAAAACGATTCAAGCATTATAAAGCATGAAACTTTG
GCTAAATTGGGGTTTGAGGCTAAGGGAGCTTTGATATCGGCTGTTGATGAGGAGTCTGAA
ACTAGGTCTATAAGAAGTCATACTTCATCTATGAATTAGGGAGCTTTATAGAAACCTAGA
GCATTGGAATATTTATAGAAAGGCAGAGATTAAAAAGAATCGACTAGAGATTTTATTCTT
AATGCCAGGAATATTTTGACTGCATAGATTGCTATTAATGATAAAACCGAGGAAACAGAA
AGGTTAAAGGAATATATTATTATGGAGAAAGAAAAGTTAGAGGAAGCCAAGAAAACTTTC
GATGAGGACCGAGACAAATTTCAAAAATACATGGAGGATCTTAATAGAAAAGCAGAGGAA
ACAGCTACAGATATTAAAATTCAGAAAAAGAAGAGCAAAATTAAGTAAATTGATGAGAAA
TTGGTTGTATATAAGCAGCACAAGGCTTTCTTAGATTTACTGGCTATATCAGCTGGGAAA
AAATAGGATAGAAGAGCGCATAGTCTAGGTGAAAGTATTGGAAATAGTGGAGGTATTGCA
GGTGGAGCGAGGAAAGATAGCAGACCTGAGTCTTAAACTAAAGCTTCTAGGTTGTCAAAG
AAAGAAGGGGGACCAGGATTTTTCTTGACTTAAGCTAATTAAAATGGTCAAAAACATAAA
AATTCATTGGATAAGTAGGACGACCTCGATTAAGAAGCTTAAATGTTCGAAGAAGACGAA
GATTTCCAAATATATTTCGACAAATTCACTCTCCTTGAGCATCTCTCTCATCTCGAAGAA
GACAACCTCTTTAAAATCCATTTAGTCTAGGAAGACGAGTAAGCTTTGGATAAGCTCAGA
AGAGCCATCGACCTAAAAATAAAGCAGAAGGAACAGGAAATTGAAGATGTAGGCAACAAC
ATTGAAATGCTTATATCCTCTAAGAATCAACTGCAAACTAAGCAGTCATTTTTAGACACA
AACATGCGAGTGAAGTAAACTTCATCATCAGCACAACATGCACATAATTCTGTTTAGGGA
GGTAGTGTCATAGGGCATTCTAGCACGATTAGACAGCCTAATCATGATAATTCAAGGTTG
ATCAATCAGTCGCATGACTAGACTTTAGGAGGGAATGAGGGAAGTGAAAAAACAAATGCA
ATGAGCATGCTACAATCGTTAACAGGTTGCTCCAAAGATAATATTAATAAGCTTAATTCA
CTCATTTCTATCATACTTGAAAAGGCTGGTATAAAGCAAGATGACCAAACAGACAAGATA
GAAATGCTTCGTAAAATAGAACAAAAACTAAATTACTTAGCTGAAGCCAAAGACTACATA
GCGAATGGCAATAAAAAGAAAGACCTTGATGTCAAAGAAAAAGAGCTGCATATCATGCGC
AAAGAGCAAAACATCCAAAAGACCAAAATGAGAGAGCAATTAATTCAAGAAGAGAGACAG
AGGAAAAATAGAGAGAGGATTAGAAAACAGGAGAACTTTAAGATATTCAAGGGGAGGAAG
GATATGCATAGGGCTAGGAAGGCTGATCTCAAACCCAAGGAGAAAACTGATGATACTCCC
AATCAAGAAGTCATTGATCAGATTAGGTATTTGGGAGGAAAGTTAGTGGATGAGGATTAA
TAACCTGTTAAGTGA


>Contig19788.0.g51(protein)
MIPKHTRTSSGLQIKPKQQKQDPILSQRKRVFCGEHLEEVVHIQQNSAHQVTRQYCKECL
QIDHTTFNIDEGGQQSTQQLESIFHRNLEMSQQLLIQSNLAIKQYASVYSKASRLLNQSV
KDVIQEAKHSVISMLEDYFDQNNCQNIKDRMYSEKLKQLDDLKNQYQTIVKNLTNINEQA
LLNYRHLQEDLCWHISTLLNQSPVKRQEQLLQNMSYSDDETEHAKKLVNNLNTYNQLGSR
GGQFKSNHSNFNIMDSFRANQSIEYSEHNNSLLQGSEGGAGTFENLIYKQSQSIQSLEQG
NNEESEEDSLAEETNFQKEAFTHYLDEQLEKIHKMQNKQYTNGLSNNQQDFNVAMHNNEI
QRLKDVVEREEENCKQRLLKLKKQKEEEDEKFKTVTNVRYQLQNMLKKDLYFIKGESSEI
FIYDLNSSKFKVQKFENFTSKFPKNFSSVQMLNRDIFLFGGVYQQSKYSQKTLQIKLSST
KYKQQICEKSQMISPKINIPICLIKNRYAYLCGGFYNKMLTDCDIYSIEEDRWFEGPKLN
YPRANCALCPFDDRFIYIFCDAGLHGSSNLMKSIDEDLSLSLDYKWEVIEVKDQKEFIAN
IHFNGVIQISPKDILIFGGQNRQSFRFEIDSKKNKESMIKMDSKFNVRQMSKFVYEKDFQ
AIVQQNQLFAIDPNYKTVHILEINKLLEESQNIDKYLPKPGQTEEDKVVGVGEENKKQPT
MWMSNLRLKQMHQLSPGPSKSKMMPSKKVLVKKSFQEFSQAAATINLNNSSHTEANNTLW
EIKTFKEIGINIANVVYFTLNKMSFKYNNFMGGLGLTTQQEQYESRTSGNNQLIPYASNN
SASNKQFNQPLFNIKEGRASSRGSHQNFKQQDSLFGQNKQHNGAMTVGNALMNFRNQRGR
SIQSAGKPPIGSYPGQLPTLGLNRYKNVDIKNGENSKNPFSIQSQTEKLLIARERERENR
DMNRMHSDGLRVFQKTIQNRQNRAGVIREINDIKPTKNGKTDQLMLMNASYEDQQQIQQQ
NKKLNIFDENDSSIIKHETLAKLGFEAKGALISAVDEESETRSIRSHTSSMNQGALQKPR
ALEYLQKGRDQKESTRDFILNARNILTAQIAINDKTEETERLKEYIIMEKEKLEEAKKTF
DEDRDKFQKYMEDLNRKAEETATDIKIQKKKSKIKQIDEKLVVYKQHKAFLDLLAISAGK
KQDRRAHSLGESIGNSGGIAGGARKDSRPESQTKASRLSKKEGGPGFFLTQANQNGQKHK
NSLDKQDDLDQEAQMFEEDEDFQIYFDKFTLLEHLSHLEEDNLFKIHLVQEDEQALDKLR
RAIDLKIKQKEQEIEDVGNNIEMLISSKNQLQTKQSFLDTNMRVKQTSSSAQHAHNSVQG
GSVIGHSSTIRQPNHDNSRLINQSHDQTLGGNEGSEKTNAMSMLQSLTGCSKDNINKLNS
LISIILEKAGIKQDDQTDKIEMLRKIEQKLNYLAEAKDYIANGNKKKDLDVKEKELHIMR
KEQNIQKTKMREQLIQEERQRKNRERIRKQENFKIFKGRKDMHRARKADLKPKEKTDDTP
NQEVIDQIRYLGGKLVDEDQQPVK