Identifiers and Description

Gene Model Identifier

Contig637.1.g137

Standard Name

KELCH45

Aliases

Contig637_1_g137

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002420100.0000000000002999981760818895TRAF-type zinc finger family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig637.1.g137(coding)
ATGGACGCCCTGCCATCCTCCTCATCCATCGATGAATCCAACACAAAATCACAGTCTTAT
GTTTACGAAGATGACTACATAGACAACAAGCCAGATGTCCAAGCTTTCATTCCCGAATTA
GTATGTGGAGTATGCAACTACATACTGAAGAACCCCCTAGAATGCAAGGTCTGCGAGAAG
CCTATTTGCTCAGACTGCAAAGTTCAATGGTTTGCCAAGAACCCCAATCATTGTCCTTTC
TGCAGAAGCAACAGCCAGTTTGATAAAGTTAACAGAATAACAAGGAATCTTCTCGGTAAA
ATCAGATTCCAGTGCATTTACAGAGACAAGGGGTGCAAGGAAGTGTTCCCCTATGCTGAT
ATTTTCAAACATTAAGACACTTGCCCTACAATTATATTCAGGTGCTAGCATTGTTCTTAT
GTCGGGCATAACGACGATAAGCCTCTTCACAATTGCATTTCTTACCTGACTGAGCAAATA
AACCAAGCCAATCAAGATAACACCAAGCTTCGTGGCATCATCTAGTCAAACAAAGATAAA
AACAATGTCTTCGCCAGCAAACTTTTCTATTTTGCTAAGCTCAACTAACATGCCTACTAT
GACTTCGAAACTCTGAAATGGTCCAGTTTTAAGGTTTTCGACAGAAAAATCAGCGAGGGG
AAGATTGTAGTGCTAGACAAGTCAAATATACTGATTATTGGTGGGTATGAGAGCGAGTCA
TTCGATTGGAGTAGTGATGTGCCCAGCTCATAGATCATTCAGTTCAATATTCCATCCAAA
AAGTTCAAAACTATAGGTGAAATGATGAATAATAGAATCTACTTCGGTATAGCTCAGGAA
GAGGATGAAATTTATATTATAGGAGGTTCTCTCAAAGGTTCAGATTTGAAATAATGCGAG
ACTTTCAATACTACATCTAAATGGCAATAAGCCCTTCCATAACTCACTCAAGCAGTGAGA
GGACCAAATTGTTGCACATTCACAAAGAGATATGTGTACACTGTAGGTTTTGAAACTTAG
GGCAACCGCACTTCTATCCAATAATTGGACTAACAAAGAGGCAACTGGTAAATAATTCAT
ATAATGTCTGAGAAAAAGATCTGGCTAGTAGGTCTTCACATGCTTAATGCAGAAACAATG
ATTATGTTTGGCGGTTAAGCAATTTCAGACAACAACTTGAAATTCAACCAGATTATAAAG
TACAAGGTGTCAAACAACAAAATAATCCCTCAGGAGCAGCAACTTATGAAAGCTGACAAG
TTCTTCTTCAACAACCAAAATATATTTGATAAGGAGTCGAACTCGTTGTACTCCATGGGC
AGAGACTACATTCATAAGGTCAGTTTGGATAAGATGAGCTGCTTCATCCCTGATGTTGGA
TATGTGGAATATTACTCTCAGTGA


>Contig637.1.g137(protein)
MDALPSSSSIDESNTKSQSYVYEDDYIDNKPDVQAFIPELVCGVCNYILKNPLECKVCEK
PICSDCKVQWFAKNPNHCPFCRSNSQFDKVNRITRNLLGKIRFQCIYRDKGCKEVFPYAD
IFKHQDTCPTIIFRCQHCSYVGHNDDKPLHNCISYLTEQINQANQDNTKLRGIIQSNKDK
NNVFASKLFYFAKLNQHAYYDFETLKWSSFKVFDRKISEGKIVVLDKSNILIIGGYESES
FDWSSDVPSSQIIQFNIPSKKFKTIGEMMNNRIYFGIAQEEDEIYIIGGSLKGSDLKQCE
TFNTTSKWQQALPQLTQAVRGPNCCTFTKRYVYTVGFETQGNRTSIQQLDQQRGNWQIIH
IMSEKKIWLVGLHMLNAETMIMFGGQAISDNNLKFNQIIKYKVSNNKIIPQEQQLMKADK
FFFNNQNIFDKESNSLYSMGRDYIHKVSLDKMSCFIPDVGYVEYYSQ