Identifiers and Description

Gene Model Identifier

Contig12431.0.g47

Standard Name

KELCH41

Aliases

Contig12431_0_g47

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669109.997093137033517e-262Protein kinase domain containi
ng protein
SGDYDL159W2.9992476920535046e-16STE7 SGDID:S000002318, Chr IV
from 172481-174028, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12431.0.g47(coding)
ATGTTTAGAAAACAGGATTTCAAGAAAATTGATTTACTTGGATCAGGCAAGAAAAATACA
AAGATTTATAAAGCAGAGCACATCCCAACTGGAAAGTTTTACGCCATCAAAGAAGTAGAA
GCTAAGACTTTAGATAAACTTAATGAGTACAAAGAAGAAGCAGTACAATTGTATAAAGTG
CAGAATCATCCAAATGTGCTACAGTTTTTTGGATACTATTTCTACGAGACTATGTACAAT
ACTTTCAGAATATCAATGGTCTGCGAGTACATGGACCACAGAACCAATCTCGAGTACATG
TTTAGAAAGAGAAAGAACGCCAATTTATATTGGAAAATGGATGAAATTGAAAAAATGATT
GTTAGCGTCATCTCAACTCTATCTTATTTACAGTCTGTTGGTATTTGTCACAGGGACTTG
AAGCCAGCCAACCTCTTCCTTAACACTTCGAATGGTGAGGTGAAAATTATTGATTTCGGA
GAATCCAAAGATTATTTCAAAGACGCTGATGATGGTGGCATGGGGACAATGGCTACTATT
AGAGGCACACCTCAATACTTATCTCCCATTCTATGGAGAGCCCATGTCGAGGAAGGTGGA
AACACTAGACATGTAACACATAACATATTCAAGAGTGATGTCTTCTCGGTGGGTTTGATT
GTTTATCAATTCGCAGCTATGGAAGATGTTACCGGTTTCAATCAGAAAAATCAAGCCAAT
GATGGCGAAAAGCTCATCGAGCAAGGCTTAAGAAAAATGAAACAGCGTTACTCTGATCAC
ATCCTAGAAATCATCAGACTCATGCTTAAATTTGAGGAAAGTGAAAGACCTAGTTTCATC
GAATTGGCCAAGTTAGTCTTAACTTCCACTGAAAACACAATAGATTCACCGAAAGGTGGT
AAACATCCTATTGGTGGAAGTGGCAGCACAGCAGCTATCCAAAAAAGCATTGAGCAGAGC
AATCAGAACAAAAGAGTCAACAAAACTTTCAGTAATTAAAATTTCAAAGAAAACAGCAGC
AACGTCAACATAAATCTTGAGTCATAGATTTCAAGCAACTAAGTGATTAACATGCAAAAC
AAGAGAGACAGCAAGCAAGGTGGAGGAGGTTCTTCCAATTAAATTATTCAAGGAATGATT
GATGAAAGCTCAAATAATTTAATGACTCAAGGGGAACTCTTCAGAAACTACGCTGAATCT
AGTAAACTTTACCTTAACTTAACCAATCAAATGTATTGGTTTGAATTTGGAGGCAATAAA
ATAGGAAGATTGTTCATTGAGGGACCAGAGGCTGAAGAATTCCCAAAATGGAGACTTATA
GCAAAGTACAAAGGTGAATTTTCAAGTCATTTCACAATGGTTTATATCAATGGAGGTGCT
GTGGGCACTAATGATATTATCTCTACTTAAATGAATAAGAATGTAGGAACATGGTTTTTG
TTGGGAGGAATGGGCAATAACAACTGCCTGTAGTATATTGATAAGAATATAGTTTCCAGG
TCTCCAATGCCACTGGAGAAATCATTCTTCGCAGCAGTTGCCATCAAAGCTTAATAAATT
TATACTTTTGGAGGTTATGAAAATGTGGAAAAATGTTAATTGAAGAGCTGTGAGTACTAC
AACATTGAGAAGGACAAGTGGTACACTAACGATGAAGTTCAGTTAAATGAGGCAAGATCG
CAATGCTCTGCAGCTTTATTTGAAGATAACATAATTTTCATATTTGGTGGTTACAACAAG
GAGAAGGGCACTTTGAGTTCAATCGAGAGATACGACATAACTAAAAAGCGTATTACTCTC
TTGGAAATTTAAATGCCACTTGCACTTAGAAGATTTGCTTCAATTAAGATTTCAGCCAGT
AAAATTCTGTTACTTGGAGGTATCGGCAGATTAAATAAGGACTCCGATGTCGTATTCTGT
TTTGACATGGATAATTAACTATAAGAAGGTGGTAAAAGTTCGCATAACCTGAATAATGTC
AAATACTCTATCGAAAACTTAGACAAAATAGACAAGGCAGGTGTGATTGAACATCCTGTT
ATCCTGGATTCAGTTGGTAGCCTGCACTTATTCGTAGAGAATGCCACTGGCACAAGCCCA
CCAGTCAGAGCTGTATACTCCTTCTTAGAGTATAGTTGA


>Contig12431.0.g47(protein)
MFRKQDFKKIDLLGSGKKNTKIYKAEHIPTGKFYAIKEVEAKTLDKLNEYKEEAVQLYKV
QNHPNVLQFFGYYFYETMYNTFRISMVCEYMDHRTNLEYMFRKRKNANLYWKMDEIEKMI
VSVISTLSYLQSVGICHRDLKPANLFLNTSNGEVKIIDFGESKDYFKDADDGGMGTMATI
RGTPQYLSPILWRAHVEEGGNTRHVTHNIFKSDVFSVGLIVYQFAAMEDVTGFNQKNQAN
DGEKLIEQGLRKMKQRYSDHILEIIRLMLKFEESERPSFIELAKLVLTSTENTIDSPKGG
KHPIGGSGSTAAIQKSIEQSNQNKRVNKTFSNQNFKENSSNVNINLESQISSNQVINMQN
KRDSKQGGGGSSNQIIQGMIDESSNNLMTQGELFRNYAESSKLYLNLTNQMYWFEFGGNK
IGRLFIEGPEAEEFPKWRLIAKYKGEFSSHFTMVYINGGAVGTNDIISTQMNKNVGTWFL
LGGMGNNNCLQYIDKNIVSRSPMPLEKSFFAAVAIKAQQIYTFGGYENVEKCQLKSCEYY
NIEKDKWYTNDEVQLNEARSQCSAALFEDNIIFIFGGYNKEKGTLSSIERYDITKKRITL
LEIQMPLALRRFASIKISASKILLLGGIGRLNKDSDVVFCFDMDNQLQEGGKSSHNLNNV
KYSIENLDKIDKAGVIEHPVILDSVGSLHLFVENATGTSPPVRAVYSFLEYS