Identifiers and Description

Gene Model Identifier

Contig22532.0.g90

Standard Name

KELCH40

Aliases

Contig22532_0_g90

Description

Regulator of chromosome condensation (RCC1) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001938474.00073564232477e-35regulator of chromosome conden
sation
SGDYGL097W7.996041293534585e-17SRM1 SGDID:S000003065, Chr VII
from 321782-323230, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22532.0.g90(coding)
ATGAATGTAATTTAGGTTGCGGCTGGGAACGAACACACATTAATCTTAACAGACTGTGGT
GATGTTTATTCAGGAGGCTACAACGAAATGGGAAATTCATTGAGTCAAGGTCCAAATGCT
ATGAGTCAAAATAACAACAATAATAATACTAGAACGGGGTAACTCAAACTTGTTGAGAAA
CTTAGAGGCAAGAATATTGTCAAAATATTTGCCTCAAATGGTTGTGAACATGTAATTGCT
TTAACTAATAATGGAAAAGTATTTTCTTTTGGTTTTAACGTAAAGGGGCAATTGGGACAT
GGCGATCAAACATCGATAAATTCTCCCAAATAAGTTGAAGCACTTTCTCGAAAATTTGTG
ACAGCAGTTGGTTGTTCATACTACCACACAATTTTCTCATGTGCAGACGAAATGGAAATA
TATTCATGCGGCAGAAACGATTATGGATAGCTAGGTTTAGGGAATTTAGATGATAAAAAT
AGTCCAACTCTTATTGAAGCCTTAAATGGAAAGAGGATAGTTTCCATAGGCTGCGGATAA
TATCATAGTGTAGTAAGTTCTATAGACGGAGAAATTTTCAGTTTTGGTAGAAATGATAGT
GGTTAGCTTGGAATAACAGGATCTGATGGTAATATAAGTTTGCCTAAGGAAGTTAAAAAT
TTAAAGAGCACATAAATTGCATGTGGTTACTACCATACAGTAGCTATAAATAATGGTCAA
CTTTATAGTTGGGGAAAGAATGATTCTGGATAATTAGGCATTGGAATCTACAGTGCGAAA
GAAATACTGCCAACTCTAGTTAGAGATTTAGAAGATCAGGAAATTGTTTCAGTCGCTTGT
GGCTGCTATCATACTTTAGCTCTTGGTTACGCAGGATAATTGTTTTCTTTCGGAAGAAAT
AGTCATGGATAGCTCGGAGATGGAACAACTAATAACTCTTGTAAACCTCTTCTGATTCAA
GGATTAATAGATAAAAAGGTCTGCTAAATTGCTGCAGGTTTCTATCATTCAATAGTCCTT
GCTAATCCAGTTATTCGAAACCCATTGGTTGAAGATTTTAAGTAGCTTTTGAATAATCAA
GAATTATCTGATGTCACTTTTATAGTAGAGGGCAAGAAGCTATATGCTCATAGATGTATT
TTAATGGCAAGATGCGAGCCTTTAGAACGAATGGTGAATGGCCACATGAGAGAAGCTTTC
GACTTATAAATTTAGATAGAGGATACAAGCTATTAATGCTTTTACTCATTGCTTGAATAT
CTCTATACTGAACAAGTTGAAGCATTGAATTAGTTTGAAACAGATATAATGACCAAAAAC
TATTGCAGTATGTCACAGATTTACATAAACTTTGCTCTTGATTTGTTGAGTCTTGCTGAT
TAATATCTTGTTGAATAATTGAAGAGAAAATGTGAAGAAGCAATACAAAAAAGCATTAAG
ATTGATGATGTTTGTTTAATGCTCAACATTGCAATAAGTAGAGGTGCTAATTCACTGAAG
AAAAGATGCCTATAGTTTATGATGAGTAATTTCTCTAAAATCATAGTATTGGATTAATTT
GTAGAACTACCAAAACATGTTTTAAAAGAAGTGTTTAAAATGGCAAATAGAAAAGGAGTG
TTTGTTAGAGAATTATTATGA


>Contig22532.0.g90(protein)
MNVIQVAAGNEHTLILTDCGDVYSGGYNEMGNSLSQGPNAMSQNNNNNNTRTGQLKLVEK
LRGKNIVKIFASNGCEHVIALTNNGKVFSFGFNVKGQLGHGDQTSINSPKQVEALSRKFV
TAVGCSYYHTIFSCADEMEIYSCGRNDYGQLGLGNLDDKNSPTLIEALNGKRIVSIGCGQ
YHSVVSSIDGEIFSFGRNDSGQLGITGSDGNISLPKEVKNLKSTQIACGYYHTVAINNGQ
LYSWGKNDSGQLGIGIYSAKEILPTLVRDLEDQEIVSVACGCYHTLALGYAGQLFSFGRN
SHGQLGDGTTNNSCKPLLIQGLIDKKVCQIAAGFYHSIVLANPVIRNPLVEDFKQLLNNQ
ELSDVTFIVEGKKLYAHRCILMARCEPLERMVNGHMREAFDLQIQIEDTSYQCFYSLLEY
LYTEQVEALNQFETDIMTKNYCSMSQIYINFALDLLSLADQYLVEQLKRKCEEAIQKSIK
IDDVCLMLNIAISRGANSLKKRCLQFMMSNFSKIIVLDQFVELPKHVLKEVFKMANRKGV
FVRELL