Identifiers and Description

Gene Model Identifier

Contig12266.0.g107

Standard Name

KELCH39

Aliases

Contig12266_0_g107

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006538000.000000000000001999258566166494Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12266.0.g107(coding)
ATGATTGTCAAAGAAACTTTTCAACTAATAGAAATTGAAATAAATTATGATTCCATGCAA
TCATTCTTGAAAGAGAGAATCAAATGTAATATTGACATGGAATAATCGAAGAAGTTAGAT
GTCTTGTTCTTTTTTCAGGAACCTTAAGTAAACAGACTTTTTTATTTCAAACCTAATACA
AAGAAAGTGTATTTTTATCATACAGACTTTCACTTAAAGTAAAAGCTACCTTTAAAAATT
GACTTTAAAATACCTGTAAACTTTGCTGCTGTTCAATTAAGATCAGGGAGGATATTTTTA
ACTGGAGGTAGCAAAAATGATACTGAGTCTTTAAATACATGCTATGAATTAATGGGACAA
AATAACGATTAAAATTTTGAAAATGTGATTAAATCTTAATCTGATGGGCTTTTGATGGAG
AGAAGGGCAAATATGAACACTGGAAGAGAAAGTCATGTTTTAGTTGCCTTGAATGCTAAA
TATATTTTTGCTATTGGAAGCAGGATATTTAAATAGAGTGGTAGTTGTGAAATTTATGAT
ATTCAACATGACACATGGAATAAAGTTAGTCCATTAAATTATGGCAGATACTACTGCTCA
GCTTGCTCATTTCAAAATAGATTTTTGTATGTGATTGGTGGCATCAATAAAAATGGCTTA
ATACCTTAAATAGAGAAATATGACTGCTTTGTTACAAACCCTACTTGGCAAGTCTTAGAA
TTAGTTGATAGTAAAATCTGGGAAGGTAGATATTTCTGTGGTTCTCATCAGATAACAGAA
AGTAAAATAATAATTTTTGGAGGGTTTTCAGGGTCAGTGATGTCGAGCACTAGTTTTGAG
CTTGACGTTGTTGCTTAAGAAATTAAAGAGTAAGGTGATACTCAGTTAGCTAGGAATGAT
TCCTTTTATCAAAGACAGCCATTATTTGGAAGCGATAAACTACTCTATGCTATTGGTTAT
GAAAGTAATATTATTCATGTATTTGCAGAAAGATGGGGTCTATTACTTAAAGATACTATT
GACTGGAAAGATTTAAATGATTAATGA


>Contig12266.0.g107(protein)
MIVKETFQLIEIEINYDSMQSFLKERIKCNIDMEQSKKLDVLFFFQEPQVNRLFYFKPNT
KKVYFYHTDFHLKQKLPLKIDFKIPVNFAAVQLRSGRIFLTGGSKNDTESLNTCYELMGQ
NNDQNFENVIKSQSDGLLMERRANMNTGRESHVLVALNAKYIFAIGSRIFKQSGSCEIYD
IQHDTWNKVSPLNYGRYYCSACSFQNRFLYVIGGINKNGLIPQIEKYDCFVTNPTWQVLE
LVDSKIWEGRYFCGSHQITESKIIIFGGFSGSVMSSTSFELDVVAQEIKEQGDTQLARND
SFYQRQPLFGSDKLLYAIGYESNIIHVFAERWGLLLKDTIDWKDLNDQ