Identifiers and Description

Gene Model Identifier

Contig2735.0.g120

Standard Name

KELCH38

Aliases

Contig2735_0_g120

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004197104.0002685161515803e-16Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2735.0.g120(coding)
ATGAATTAAGACGACAGCGAAGTGTATCAACCGTAACAGATCTCTCAAGAGCAATCCTAA
GAGTCAGCCAAGCCTACCTAAGATCCAAGTCTTTGTGAGACTCACTCTGAAGAATTAATC
CTATTCTGTTTGAAAGATCAGATACAAGTTTGCAGCAAATGTCTGAAGTCCACTCACTTG
CTTCATCCGGTTGTTCCCATCAATTCCCTTGAAAATTTAGACTTCTCAGAATCACTTGCT
TCAGAAATTAGTCAGGCGCTAGGTGAAGTCAAAAATCGTGAGAGGCTTGTAAATGATCTA
CTCTCAAAAAGCTTAACTCTTCATAAAATCAAATTGAGAAATCACATCATGTTTATAAGG
GATAATTTAAGACAGGAGTTCGATGATTTCTTCAATAGTTTACTCTAATCGATTAGAAAA
GATTGGAATCTTTTCAATGTTTAAGAAATTTTAATCTAAGAAACAAAAAAGTTCAATGAT
AAAGTTACAGTAAACCTCGATAAGATCACTGATGGTAGTCAATTACTATACCCTTAATAA
GATATAAAGAAGTTCTATGAAAGCTTAAGTGATGCTTAGGCTTAAGTTTAACAATGTAAG
AATGATTGGTCAAATTACGAGAACAATATGCAATCGTTAATTGATAGTCTAAAGGATCAT
TCAGAGTTTGAATCAATCGATGGAAACATCCTCAAATAATTTATGGCTGAGAGACTTGTA
CTCAATTATAGCAATATCGAGCTTTAAAGAATTCTGTTTTAGCAGCCTATGAAAAAGTCC
GGATCTAACTCTCCAATTGTACATCCTCAGTTTAGAAAGCATAGCTATAGTGTTATGGGA
GTAGGAAATAACAAACTTGGTTAAAGTATGGCATTCGGAAGCGATCAGTAATTGAATGGT
AGAGTAGGTATGCAATTCAGCAGCACATTACAAAAAATGGGTATAAGCAGTTAGCTCTTA
TCTAGTGAGGAGAGTATTACAAATAAACTTCACTTCTTTAAATTTGATCAGAGAATTTTA
ACATTTTACAATGTTGAGACTGATAAAAAGACTAGAGAATTATTGAACATTGAATTCAAC
ATACCCATTAGATTCTGTTCTATCTAGACTAAAGATGGTAGAATATTCATAACAGGAGGT
GCTAGAAATAGCACATAGTCTTCAAATTCGGCTTATGAATATAAAGAAGGAACTTTAGCT
CAATTGCCAAATATGCAACATCCTAGAGAAGGTCACTGCCTAGCTGCTATTGGCTCTACA
CAAATATTTGCTATAGGCTCTAGATTGTACAATACTTCAAAAACTTGCGAAGTTTATTAG
ATGGATTCAAACGAATGGAGAGAATAGCCTGAACTGAATAGAAATAGATATTTGTCTACT
GCTGTCACTTTGAATGAAAGATTCATTTATGTGCTTGGTGGATATGAGCCTTAAGTTACA
GACATTGAGAGACTAGATACCTGGAATCTGAGTCAAGGCTCGTATTGGGAGTTGATTAAG
ATTTACTCACCAAACCTTGAAAATGATATCAAGTATTGGTTTGGATCATGCCCAGTCTCA
TCTACTGAAATCTTGATATTTGGTGGTAAGAAAGATGGAGCCTCATCTTAGGCTTCTTAC
ATATTTGATACAGCAAGTAAGCAGGTAATTAAAACTGGAAATCTTCCAAACAAAGATACT
TTCTATCAAAGAACTTTCCTCTAAAAGAATGGGAAAGTTCATGCATATGGCTATGAAAAT
GATAGCGCATACATTTATAATATTTCTACTAAAACCTGGTCTAAGAAGTGA


>Contig2735.0.g120(protein)
MNQDDSEVYQPQQISQEQSQESAKPTQDPSLCETHSEELILFCLKDQIQVCSKCLKSTHL
LHPVVPINSLENLDFSESLASEISQALGEVKNRERLVNDLLSKSLTLHKIKLRNHIMFIR
DNLRQEFDDFFNSLLQSIRKDWNLFNVQEILIQETKKFNDKVTVNLDKITDGSQLLYPQQ
DIKKFYESLSDAQAQVQQCKNDWSNYENNMQSLIDSLKDHSEFESIDGNILKQFMAERLV
LNYSNIELQRILFQQPMKKSGSNSPIVHPQFRKHSYSVMGVGNNKLGQSMAFGSDQQLNG
RVGMQFSSTLQKMGISSQLLSSEESITNKLHFFKFDQRILTFYNVETDKKTRELLNIEFN
IPIRFCSIQTKDGRIFITGGARNSTQSSNSAYEYKEGTLAQLPNMQHPREGHCLAAIGST
QIFAIGSRLYNTSKTCEVYQMDSNEWREQPELNRNRYLSTAVTLNERFIYVLGGYEPQVT
DIERLDTWNLSQGSYWELIKIYSPNLENDIKYWFGSCPVSSTEILIFGGKKDGASSQASY
IFDTASKQVIKTGNLPNKDTFYQRTFLQKNGKVHAYGYENDSAYIYNISTKTWSKK